Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35150 68 / 5e-15 O-methyltransferase family protein (.1) AT4G35160 67 / 2e-14 O-methyltransferase family protein (.1) AT1G51990 64 / 3e-13 O-methyltransferase family protein (.1.2) AT1G21100 62 / 8e-13 IGMT1 indole glucosinolate O-methyltransferase 1, O-methyltransferase family protein (.1) AT1G21130 62 / 8e-13 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2) AT1G21110 62 / 9e-13 IGMT3 indole glucosinolate O-methyltransferase 3, O-methyltransferase family protein (.1) AT1G33030 62 / 1e-12 O-methyltransferase family protein (.1) AT1G21120 60 / 5e-12 IGMT2 indole glucosinolate O-methyltransferase 2, O-methyltransferase family protein (.1) AT1G76790 59 / 2e-11 IGMT5 indole glucosinolate O-methyltransferase 5, O-methyltransferase family protein (.1) AT1G62900 56 / 1e-10 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015311 [exp] 180 / 2e-57 AT4G35160 189 / 1e-56 O-methyltransferase family protein (.1) Lus10033656 [exp] 113 / 2e-31 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1) Lus10013945 [exp] 111 / 9e-31 AT4G35160 181 / 1e-53 O-methyltransferase family protein (.1) Lus10017699 [exp] 107 / 4e-29 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1) Lus10008538 [exp] 102 / 4e-27 AT4G35160 167 / 5e-48 O-methyltransferase family protein (.1) Lus10033655 [exp] 95 / 1e-24 AT4G35150 193 / 3e-58 O-methyltransferase family protein (.1) Lus10017695 [exp] 93 / 1e-24 AT4G35150 140 / 6e-40 O-methyltransferase family protein (.1) Lus10018628 [exp] 92 / 2e-23 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1) Lus10017691 [exp] 91 / 3e-23 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G059600 [exp] 140 / 5e-42 AT4G35160 196 / 3e-59 O-methyltransferase family protein (.1) Potri.004G050500 [exp] 139 / 1e-41 AT4G35160 178 / 2e-52 O-methyltransferase family protein (.1) Potri.019G093200 [exp] 117 / 1e-35 AT4G35160 78 / 4e-18 O-methyltransferase family protein (.1) Potri.019G093000 [exp] 116 / 1e-32 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1) Potri.004G050400 [exp] 115 / 3e-32 AT4G35160 191 / 2e-57 O-methyltransferase family protein (.1) Potri.019G093100 [exp] 113 / 1e-31 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1) Potri.011G059500 [exp] 112 / 4e-31 AT4G35160 177 / 6e-52 O-methyltransferase family protein (.1) Potri.013G120800 [exp] 103 / 7e-28 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1) Potri.013G122100 [exp] 94 / 1e-26 AT4G35160 65 / 2e-13 O-methyltransferase family protein (.1) Potri.013G122400 [exp] 98 / 8e-26 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00891 [flax] [poplar] Methyltransf_2 O-methyltransferase domain
Representative CDS sequence Show only first row Show all	>Lus10025440 pacid=23150865 polypeptide=Lus10025440 locus=Lus10025440.g ID=Lus10025440.BGIv1.0 annot-version=v1.0 ATGCATGGATGGAAAGATGAAGAATGTGTTCAAATACTGAAGAAATGCAAGGAAGCAATACCAAGCAAAGGCAAAGTGATGATCATAGACATAGTGATCA ACGAGGAGAAAGATGAACATGAATTGAGTGGGACTAAGCTCTTGTTTGATATGCTGATGTTGATTGTGGTTAATGGCAAAGAAAGGACTGAGAAAGAATG GAAGAAATGGTTCTTGGAAGCTGGTTCTGATCACTATAAGATCACACCTTTGTTTGGTCTTAGGCCACCTATTGAGGTTTTCCCTTGA
AA sequence Show only first row Show all	>Lus10025440 pacid=23150865 polypeptide=Lus10025440 locus=Lus10025440.g ID=Lus10025440.BGIv1.0 annot-version=v1.0 MHGWKDEECVQILKKCKEAIPSKGKVMIIDIVINEEKDEHELSGTKLLFDMLMLIVVNGKERTEKEWKKWFLEAGSDHYKITPLFGLRPPIEVFP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35150			O-methyltransferase family pro...		Lus10025440 [exp]	0	1
AT5G08630			DDT domain-containing protein ...		Lus10039626 [exp]	1.0	0.8964
AT3G50780			unknown protein		Lus10016789 [exp]	6.2	0.7917
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10016156 [exp]	7.9	0.8509
AT3G53730			Histone superfamily protein (....		Lus10040849 [exp]	10.5	0.8473
AT5G05080		ATUBC22, UBC22	ubiquitin-conjugating enzyme 2...		Lus10027282 [exp]	13.3	0.7964
AT5G04520			Protein of unknown function DU...		Lus10017450 [exp]	14.6	0.7571
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10032315 [exp]	17.9	0.8037
AT5G19370			rhodanese-like domain-containi...		Lus10000413 [exp]	17.9	0.7825
AT3G53730			Histone superfamily protein (....		Lus10005896 [exp]	18.1	0.8202
AT5G44560		VPS2.2	SNF7 family protein (.1.2)		Lus10023396 [exp]	20.5	0.7885

Compare expression of checked genes

Lus10025440 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.