Lus10025443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28280 117 / 4e-33 VQ motif-containing protein (.1.2)
AT2G33780 67 / 8e-14 VQ motif-containing protein (.1)
AT3G15300 62 / 6e-12 VQ motif-containing protein (.1)
AT5G53830 49 / 2e-07 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015315 218 / 2e-72 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10005543 56 / 2e-09 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10041929 50 / 2e-07 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G053700 118 / 5e-33 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Potri.004G044800 117 / 2e-32 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G118200 81 / 5e-19 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.001G399100 78 / 8e-18 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10025443 pacid=23150807 polypeptide=Lus10025443 locus=Lus10025443.g ID=Lus10025443.BGIv1.0 annot-version=v1.0
ATGCTCACCGGTTCACCCAAACCCGACCCGAAACCCGCGATCAAATCCTGCCCGATCAAGAGGAGCCAATCCTCCTCCTCCGGATTCAAGCTCTACGAGC
GGAGGAACTCGCTCAAGAACCTCAGGATCAATCCGCTCAACCCTTTCCTCGCCGGATCCGGATTCCCTTCGCCCCGAAATCAACAACCCGAGATCCTCTC
CCCTAGCATCCTCGATTTCCCGGCTCTAGCCCTCAGCCCCGTCACCCCCTTGATACCCGACCCGTTCGATCGATCCGGAACTTCACGATCCGGATTCGTC
AGCAGTCCGATGAGTGGCGGTGCTACTCCGGCGAGCAACCTCATGGAAACGGAGGATGAGGAGGAAGAAAAGAAGGCGATTAAGGAGAGGGGATTCTATC
TACACTGTTCGCCGGCGACGACGCCCAGAGAAGCGGAGCCACCGCGGTTGCTGCCGCTCTTCCCGGTGGCGTCTCCCAGAGTCGCTGCTGGTTCAGCTAG
TGCTTCGTCCTGA
AA sequence
>Lus10025443 pacid=23150807 polypeptide=Lus10025443 locus=Lus10025443.g ID=Lus10025443.BGIv1.0 annot-version=v1.0
MLTGSPKPDPKPAIKSCPIKRSQSSSSGFKLYERRNSLKNLRINPLNPFLAGSGFPSPRNQQPEILSPSILDFPALALSPVTPLIPDPFDRSGTSRSGFV
SSPMSGGATPASNLMETEDEEEEKKAIKERGFYLHCSPATTPREAEPPRLLPLFPVASPRVAAGSASASS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28280 VQ motif-containing protein (.... Lus10025443 0 1
AT1G28280 VQ motif-containing protein (.... Lus10015315 6.9 0.6843
AT5G20130 unknown protein Lus10037880 13.2 0.6140
AT1G78190 Trm112p-like protein (.1) Lus10024634 15.5 0.6098
AT3G14180 Trihelix ASIL2 Arabidopsis 6B-interacting pr... Lus10025404 29.5 0.6102
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10020390 30.2 0.5935
AT3G53810 Concanavalin A-like lectin pro... Lus10001562 31.7 0.5700
Lus10040041 43.5 0.5795
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Lus10011167 44.8 0.5829
AT5G49210 unknown protein Lus10043148 45.2 0.5519
AT1G14060 GCK domain-containing protein ... Lus10030441 49.1 0.5405

Lus10025443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.