Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33830 83 / 3e-22 Dormancy/auxin associated family protein (.1.2) AT1G28330 79 / 2e-20 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) AT5G44300 76 / 2e-19 Dormancy/auxin associated family protein (.1) AT1G56220 49 / 2e-08 Dormancy/auxin associated family protein (.1.2.3.4) AT1G54070 39 / 8e-05 Dormancy/auxin associated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015318 [exp] 159 / 2e-52 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013997 [exp] 90 / 4e-25 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015418 [exp] 87 / 4e-24 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013996 [exp] 73 / 1e-18 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10031488 [exp] 50 / 5e-09 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10015193 [exp] 50 / 7e-09 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10020661 [exp] 48 / 3e-08 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 48 / 8e-08 AT5G27830 245 / 9e-80 unknown protein Lus10008142 [exp] 39 / 0.0001 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G047100 [exp] 71 / 3e-17 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Potri.013G014900 [exp] 45 / 2e-07 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.005G024250 [exp] 44 / 3e-07 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4) Potri.001G164800 [exp] 39 / 6e-05 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1) Potri.003G070500 [exp] 37 / 0.0002 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [flax] [poplar] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Lus10025446 pacid=23150813 polypeptide=Lus10025446 locus=Lus10025446.g ID=Lus10025446.BGIv1.0 annot-version=v1.0 ATGGTGTTGCTTGATAACTTGTGGGACGACGTGGTGGCTGGTCCTCAGCCTGAGCATGGCCTCGGCCGCCTCCGTGGCACCAAGACCTTGACCATCCCAG ATGGGGATGCTGGAGGGAGCCTGCAGCTCCAGAAGCCCACGGCGATGCCGGAGAGCCCGAGGACTCCGGTGACACCAGGATCAGCGACGAAGGACAACGT GTGGAGGAGCGTGTTCAGCCCAGGGAGCAACCTAGCCACCAGGTCCGGCCATGCCATGTAA
AA sequence Show only first row Show all	>Lus10025446 pacid=23150813 polypeptide=Lus10025446 locus=Lus10025446.g ID=Lus10025446.BGIv1.0 annot-version=v1.0 MVLLDNLWDDVVAGPQPEHGLGRLRGTKTLTIPDGDAGGSLQLQKPTAMPESPRTPVTPGSATKDNVWRSVFSPGSNLATRSGHAM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33830			Dormancy/auxin associated fami...		Lus10025446 [exp]	0	1
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015318 [exp]	1.0	0.9008
AT5G02180			Transmembrane amino acid trans...		Lus10024374 [exp]	2.4	0.8943
AT3G51430		SSL5, YLS2	YELLOW-LEAF-SPECIFIC GENE 2, S...		Lus10028376 [exp]	2.8	0.8503
AT3G26740		CCL	CCR-like (.1)		Lus10012569 [exp]	3.7	0.8555
AT1G06240			Protein of unknown function DU...		Lus10033620 [exp]	4.9	0.8917
AT1G08860		BON3	BONZAI 3, Calcium-dependent ph...		Lus10033826 [exp]	6.6	0.8041
AT1G75220		AtERDL6	ERD6-like 6, Major facilitator...		Lus10001656 [exp]	8.5	0.8227
AT5G38510			Rhomboid-related intramembrane...		Lus10023145 [exp]	8.5	0.8809
AT5G20220			zinc knuckle (CCHC-type) famil...		Lus10036722 [exp]	10.5	0.8747
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10005927 [exp]	10.9	0.8156

Compare expression of checked genes

Lus10025446 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.