Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30010 143 / 3e-46 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015329 [exp] 184 / 2e-62 AT4G30010 146 / 2e-47 unknown protein Lus10001443 [exp] 181 / 2e-61 AT4G30010 146 / 2e-47 unknown protein Lus10001623 [exp] 179 / 1e-60 AT4G30010 144 / 7e-47 unknown protein Lus10001622 [exp] 99 / 3e-26 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G075600 [exp] 163 / 2e-54 AT4G30010 134 / 9e-43 unknown protein Potri.018G142500 [exp] 161 / 2e-53 AT4G30010 137 / 8e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025458 pacid=23150787 polypeptide=Lus10025458 locus=Lus10025458.g ID=Lus10025458.BGIv1.0 annot-version=v1.0 ATGGCAATGAGGAGGTTCTACAGCGAGATCAAGGGGTTGAAGGTGAGGGATGTTCCGAACCACGTGAAGCCGATGCTGTCGCTCGATTTCGTGAAGAAAT CGGTGCAGAAAGGATTGGATAATTACCACGCTAAGTACATCCAGACCAGCTCCGTCGATCCTCTCTTACATGTATGCTTCGGCGGGATGGCTTTTTCCTA TCTTGTTGCCCTTCCCGAGGAGCGTCGCCATCTGGAGCACCAGCAGCACGCCAAAGAGCACAGCGGCCACTGA
AA sequence Show only first row Show all	>Lus10025458 pacid=23150787 polypeptide=Lus10025458 locus=Lus10025458.g ID=Lus10025458.BGIv1.0 annot-version=v1.0 MAMRRFYSEIKGLKVRDVPNHVKPMLSLDFVKKSVQKGLDNYHAKYIQTSSVDPLLHVCFGGMAFSYLVALPEERRHLEHQQHAKEHSGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30010			unknown protein		Lus10025458 [exp]	0	1
AT1G22520			Domain of unknown function (DU...		Lus10009454 [exp]	2.4	0.9211
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10003978 [exp]	3.5	0.8678
AT3G12260			LYR family of Fe/S cluster bio...		Lus10026163 [exp]	6.6	0.8785
AT3G19320			Leucine-rich repeat (LRR) fami...		Lus10027878 [exp]	8.1	0.8514
AT1G51650			ATP synthase epsilon chain, mi...		Lus10035755 [exp]	11.4	0.8662
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10019137 [exp]	12.8	0.8901
AT2G19790			SNARE-like superfamily protein...		Lus10012924 [exp]	14.5	0.8678
AT1G79390			unknown protein		Lus10001759 [exp]	16.2	0.8729
AT5G07960			unknown protein		Lus10034695 [exp]	16.2	0.8460
AT3G61790			Protein with RING/U-box and TR...		Lus10004001 [exp]	16.4	0.8819

Compare expression of checked genes

Lus10025458 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.