Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07745 57 / 2e-10 SSN1, ATRAD51D, RAD51D SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2) AT2G28560 40 / 0.0001 ATRAD51B, RAD51B DNA repair (Rad51) family protein (.1), DNA repair (Rad51) family protein (.2), DNA repair (Rad51) family protein (.3), DNA repair (Rad51) family protein (.4) AT5G57450 40 / 0.0002 ATXRCC3, XRCC3 ARABIDOPSIS THALIANA HOMOLOG OF X-RAY REPAIR CROSS COMPLEMENTING 3 \(XRCC3\), homolog of X-ray repair cross complementing 3 (XRCC3) (.1), homolog of X-ray repair cross complementing 3 (XRCC3) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015220 [exp] 110 / 1e-30 AT1G07745 273 / 6e-91 SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2) Lus10005437 [exp] 105 / 6e-28 AT1G07745 231 / 1e-73 SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2) Lus10038467 [exp] 43 / 2e-05 AT2G28560 430 / 2e-151 DNA repair (Rad51) family protein (.1), DNA repair (Rad51) family protein (.2), DNA repair (Rad51) family protein (.3), DNA repair (Rad51) family protein (.4) Lus10023341 [exp] 42 / 2e-05 AT2G28560 468 / 2e-163 DNA repair (Rad51) family protein (.1), DNA repair (Rad51) family protein (.2), DNA repair (Rad51) family protein (.3), DNA repair (Rad51) family protein (.4)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF08423 [flax] [poplar] Rad51 Rad51
Representative CDS sequence Show only first row Show all	>Lus10025465 pacid=23150839 polypeptide=Lus10025465 locus=Lus10025465.g ID=Lus10025465.BGIv1.0 annot-version=v1.0 ATGGCGGCCTTGGAATCCCATCATCATCCTCAACCATGGTTAGACGGCGTTGAGTTTCTGCGAGATGCAACCGTTAACAAACGCTTTCTGTCAACCGGAC TCGCTGGGTTGGATTCGTTTCTTCACGGTGGGTTGCAGGTTGGTCAATTGACCGAATTGGTTGGCCAGTCGTCAACTGGCAAAACACAATGTACAAGCTT CAAATTCAACTCAAAGTTCGACCTGAGCTCGAGTTTGGCTCGTCAAAGGTTGTTAACGAGCCAGGCTCGAGCTCGACACGAGCTAAGCTTGAGCTCGCCT AAAATGGCTGTCATTTGGTCTTTTTTCCGAGATTTCCTCGCAATTAGATCCAACAACTAA
AA sequence Show only first row Show all	>Lus10025465 pacid=23150839 polypeptide=Lus10025465 locus=Lus10025465.g ID=Lus10025465.BGIv1.0 annot-version=v1.0 MAALESHHHPQPWLDGVEFLRDATVNKRFLSTGLAGLDSFLHGGLQVGQLTELVGQSSTGKTQCTSFKFNSKFDLSSSLARQRLLTSQARARHELSLSSP KMAVIWSFFRDFLAIRSNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10025465 [exp]	0	1
AT3G25840			Protein kinase superfamily pro...		Lus10035032 [exp]	1.7	0.9035
AT5G40600		EMB1875	unknown protein		Lus10003647 [exp]	2.8	0.8944
AT5G22620			phosphoglycerate/bisphosphogly...		Lus10009404 [exp]	3.5	0.8856
AT3G27670		RST1	RESURRECTION1, ARM repeat supe...		Lus10010374 [exp]	6.0	0.8890
AT5G47900			Protein of unknown function (D...		Lus10036333 [exp]	6.0	0.8597
AT4G00290			Mechanosensitive ion channel p...		Lus10005121 [exp]	8.7	0.8333
AT1G33400		TPR9	tetratricopeptide repeat 9, Te...		Lus10026202 [exp]	8.8	0.8464
AT4G32790			Exostosin family protein (.1)		Lus10043238 [exp]	12.0	0.8377
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	12.7	0.8506
AT5G49570		ATPNG1	peptide-N-glycanase 1 (.1)		Lus10015918 [exp]	13.0	0.8511

Compare expression of checked genes

Lus10025465 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.