Lus10025469 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18910 116 / 2e-34 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006958 178 / 1e-58 AT2G18910 137 / 1e-42 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G090900 148 / 7e-47 AT2G18910 136 / 4e-42 hydroxyproline-rich glycoprotein family protein (.1)
Potri.006G166400 126 / 6e-38 AT2G18910 125 / 1e-37 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence
>Lus10025469 pacid=23150814 polypeptide=Lus10025469 locus=Lus10025469.g ID=Lus10025469.BGIv1.0 annot-version=v1.0
ATGCCAATCAACGCCGACCCATCAACTCCGCCGCCAAGCATCGGCAAAATCGGGCCATACACAGTCTTCATCACTCCTCCTCCAACTCCAACCACCGCCG
CCGCCACAACTCCGCCGCCGCAGTCTCCTTCACCGGCCATCTACGACACTCCAAAGAAGGTGGTTTGCCCTCCAGCTCCCCAGATCCAATCTTCCAACCT
TCCTTCCGCCGAAGACTCCTCATCCTCCGTCCTTGGCTTCCTCCGCACCGCTGCGACCAAGGTTCAACACGTGAATTCGAGCTTGGATGACCATTTGGCG
AGGTGGTTTGGATTGAATCAGTCCAAGTATCAGTGGGCTCTTGATGATTATTTTGAGACCAAAGGACTGGCCTCATTTGGTACGAAGATTGAGAATTTGA
GTATATTTGCGGCGAAAATGTAG
AA sequence
>Lus10025469 pacid=23150814 polypeptide=Lus10025469 locus=Lus10025469.g ID=Lus10025469.BGIv1.0 annot-version=v1.0
MPINADPSTPPPSIGKIGPYTVFITPPPTPTTAAATTPPPQSPSPAIYDTPKKVVCPPAPQIQSSNLPSAEDSSSSVLGFLRTAATKVQHVNSSLDDHLA
RWFGLNQSKYQWALDDYFETKGLASFGTKIENLSIFAAKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18910 hydroxyproline-rich glycoprote... Lus10025469 0 1
AT2G18910 hydroxyproline-rich glycoprote... Lus10006958 1.0 0.8788
AT2G05810 ARM repeat superfamily protein... Lus10035338 8.4 0.7665
Lus10034878 9.8 0.7825
AT5G11890 EMB3135 EMBRYO DEFECTIVE 3135, unknown... Lus10026428 11.4 0.8343
AT2G16850 PIP3B, PIP2;8 PLASMA MEMBRANE INTRINSIC PROT... Lus10014978 12.0 0.7770
AT2G02010 GAD4 glutamate decarboxylase 4 (.1) Lus10031934 12.1 0.7581
AT1G80690 PPPDE putative thiol peptidase... Lus10042454 15.5 0.7981
AT3G52610 unknown protein Lus10014214 17.3 0.7473
AT4G33625 unknown protein Lus10020442 18.2 0.7683
AT1G06475 unknown protein Lus10020752 20.2 0.7725

Lus10025469 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.