Lus10025488 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71490 106 / 9e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G22830 100 / 1e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G16860 79 / 3e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G08070 79 / 4e-17 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G03580 79 / 4e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G37380 77 / 9e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G11290 77 / 9e-17 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22690 77 / 1e-16 unknown protein
AT2G33760 76 / 3e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G20730 75 / 5e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009487 209 / 2e-63 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016511 80 / 2e-17 AT5G59600 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10011323 77 / 1e-16 AT5G52630 790 / 0.0 mitochondrial RNAediting factor 1 (.1)
Lus10039703 77 / 2e-16 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012206 76 / 4e-16 AT5G52630 786 / 0.0 mitochondrial RNAediting factor 1 (.1)
Lus10013319 76 / 4e-16 AT4G21065 744 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10027389 76 / 5e-16 AT5G66520 393 / 7e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007806 76 / 5e-16 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035815 76 / 6e-16 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G074700 140 / 9e-39 AT1G71490 878 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G014900 87 / 6e-20 AT5G59600 334 / 6e-108 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G103600 82 / 4e-18 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G083700 79 / 4e-17 AT3G22690 1050 / 0.0 unknown protein
Potri.017G086100 78 / 6e-17 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 77 / 2e-16 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G231200 77 / 2e-16 AT5G66520 504 / 1e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G243800 76 / 2e-16 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 76 / 3e-16 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G047800 76 / 4e-16 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10025488 pacid=23145120 polypeptide=Lus10025488 locus=Lus10025488.g ID=Lus10025488.BGIv1.0 annot-version=v1.0
ATGATCTCACAAGCCAAGGGAATCTGTGCAAGGCATTCAAAACATTTTCGTTATTGCAACGACATGCTCTCACATCATGACTCACACGTGGATTCAATTG
CGTGTCTTTTGTTTGCTTGTGCTGCTCGGAAATCGACTTGGCAAGGAAGAAGACAGCTCCACAGAGCATATGATCTCGTTAGGAATGAGCTGTGTGGGGA
GGCTCTTTCTGCTTATACGGAGATGAGGAGTAAAGGAGGAGTTCACAGCTCCATTAGAGCTAGCAATCATCGCTGGAATTTGTTTGTGCATAATGCATTA
ATATCAATGTACAGTAAAACCGGGGAGCTAGAAGTTGCACGGTGTTTGTTTGACGAGATGCCGGCTAGGGATGTTGTGTCTTGGAATTCAATTATTGGTG
GTTATGCTTCAAAGGGAATATGGAAGGAAGCCATTGAGCTGTTCGAAAGAATGCAGTCAGAAGTTGGTAAGAATATAAACAACATAACGTGGAATACTTT
TGCTAAATGCTGTTCGCGTTCTGGAAATTTCTTAGGTGTCCTGGACTTGCTCTCTAAATGA
AA sequence
>Lus10025488 pacid=23145120 polypeptide=Lus10025488 locus=Lus10025488.g ID=Lus10025488.BGIv1.0 annot-version=v1.0
MISQAKGICARHSKHFRYCNDMLSHHDSHVDSIACLLFACAARKSTWQGRRQLHRAYDLVRNELCGEALSAYTEMRSKGGVHSSIRASNHRWNLFVHNAL
ISMYSKTGELEVARCLFDEMPARDVVSWNSIIGGYASKGIWKEAIELFERMQSEVGKNINNITWNTFAKCCSRSGNFLGVLDLLSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71490 Tetratricopeptide repeat (TPR)... Lus10025488 0 1
AT2G04560 AtLpxB lipid X B, transferases, trans... Lus10035357 12.0 0.8191
AT1G06410 ATTPSA, ATTPS7 TREHALOSE -6-PHOSPHATASE SYNTH... Lus10007311 16.0 0.8137
AT5G54280 ATMYOS1, ATM4, ... ARABIDOPSIS THALIANA MYOSIN 1,... Lus10037876 18.0 0.8134
AT5G46560 unknown protein Lus10011046 21.8 0.7986
AT2G24640 UBP19 ubiquitin-specific protease 19... Lus10026918 26.2 0.8127
AT1G79490 EMB2217 embryo defective 2217, Pentatr... Lus10037515 29.9 0.8056
AT5G15340 Pentatricopeptide repeat (PPR)... Lus10014653 38.6 0.8030
AT2G43190 ribonuclease P family protein ... Lus10019913 50.6 0.7739
AT3G54460 SNF2 domain-containing protein... Lus10024158 51.1 0.7811
AT1G80150 Tetratricopeptide repeat (TPR)... Lus10019119 51.5 0.7941

Lus10025488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.