Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027007 [exp] 46 / 7e-08 ND 41 / 8e-06 Lus10008346 [exp] 40 / 4e-05 ND / Lus10003510 [exp] 0 / 1 AT1G33980 200 / 9e-61 Smg-4/UPF3 family protein (.1.2) Lus10009488 [exp] 0 / 1 AT1G33980 167 / 5e-47 Smg-4/UPF3 family protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025489 pacid=23145011 polypeptide=Lus10025489 locus=Lus10025489.g ID=Lus10025489.BGIv1.0 annot-version=v1.0 ATGGCGAAAGGAAATCAGAAGAAGGAAGCTTACAAGAGAACCAAAGTGGTGGTAAGGCATTTGCCTCCTTCAGTTCACTATCTCGTTCGGAGCTATTCTC CCACTTCGGTCATCTCTTCTCCGATCGGGTCAATTGGGTCTCTTTCCAACCCGGAAAGTCCAGTAGTAACAGTCAGAATCAGAGGCATTCTCGTGCTTAT ACTGACTGACTTCAAGAGCCCGCCCTGGAGATGTGATGGAGTTTGCACAGTTCTTCAATGGGCATAG
AA sequence Show only first row Show all	>Lus10025489 pacid=23145011 polypeptide=Lus10025489 locus=Lus10025489.g ID=Lus10025489.BGIv1.0 annot-version=v1.0 MAKGNQKKEAYKRTKVVVRHLPPSVHYLVRSYSPTSVISSPIGSIGSLSNPESPVVTVRIRGILVLILTDFKSPPWRCDGVCTVLQWA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025489 [exp]	0	1
AT4G15040			Subtilisin-like serine endopep...		Lus10028843 [exp]	1.0	0.7621
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10042680 [exp]	6.3	0.7592
AT5G43650	bHLH	BHLH92, bHLH092	basic helix-loop-helix (bHLH) ...		Lus10008804 [exp]	8.4	0.7254
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10024296 [exp]	10.2	0.7590
AT3G08990			Yippee family putative zinc-bi...		Lus10035531 [exp]	11.7	0.7356
AT4G27570			UDP-Glycosyltransferase superf...		Lus10001858 [exp]	22.3	0.7493
AT1G10520		AtPol{lambda}	DNA polymerase {lambda}, DNA p...		Lus10030656 [exp]	30.6	0.7542
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10028781 [exp]	160.2	0.6483
AT4G29400			Protein of unknown function (D...		Lus10012917 [exp]	180.4	0.6421
AT3G18150			RNI-like superfamily protein (...		Lus10029433 [exp]	182.8	0.6508

Compare expression of checked genes

Lus10025489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.