Lus10025494 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01430 184 / 5e-61 Got1/Sft2-like vescicle transport protein family (.1.2)
AT3G49420 184 / 5e-61 Got1/Sft2-like vescicle transport protein family (.1)
AT3G03180 159 / 3e-51 Got1/Sft2-like vescicle transport protein family (.1)
AT1G05785 103 / 2e-29 Got1/Sft2-like vescicle transport protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026704 197 / 1e-65 AT3G49420 225 / 1e-76 Got1/Sft2-like vescicle transport protein family (.1)
Lus10019570 108 / 2e-29 AT1G05785 187 / 2e-59 Got1/Sft2-like vescicle transport protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G036000 186 / 4e-62 AT5G01430 201 / 2e-67 Got1/Sft2-like vescicle transport protein family (.1.2)
Potri.007G124400 186 / 6e-62 AT5G01430 199 / 5e-67 Got1/Sft2-like vescicle transport protein family (.1.2)
Potri.014G151000 115 / 4e-34 AT1G05785 157 / 3e-50 Got1/Sft2-like vescicle transport protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04178 Got1 Got1/Sft2-like family
Representative CDS sequence
>Lus10025494 pacid=23145094 polypeptide=Lus10025494 locus=Lus10025494.g ID=Lus10025494.BGIv1.0 annot-version=v1.0
ATGGTTTCGTTTGAAATGAATGATCGCAAAAAAATTGGGATGGGACTGACAGGATTTGGCATCTTTTTCTCCTTTCTGGGGATCGTCTTCTTCTTTGACA
AGGGACTACTTGCCATGGGAAATATCCTCTTTATCTCTGGAGTGGGTCTCACTATTGGACTGAAGTCTACTATGCAGTTCTTCATGAAACGTCAAAACTA
TAAGGGGACTATCTCATTTGGTGCAGGTTTCTTCTTTGTTGTGATAGGATGGCCCATTATTGGCATGATTCTGGAGACTTATGGGTTTGTTATGCTCTTC
AGTGGCTTCTGGCCAACACTCTCGGTATTCATCCAGAGGATACCAGTTCTTGGTTGGATCTTCCAGCTACCAGCAGTCAGAGCAGTAAGTGATCATTGA
AA sequence
>Lus10025494 pacid=23145094 polypeptide=Lus10025494 locus=Lus10025494.g ID=Lus10025494.BGIv1.0 annot-version=v1.0
MVSFEMNDRKKIGMGLTGFGIFFSFLGIVFFFDKGLLAMGNILFISGVGLTIGLKSTMQFFMKRQNYKGTISFGAGFFFVVIGWPIIGMILETYGFVMLF
SGFWPTLSVFIQRIPVLGWIFQLPAVRAVSDH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49420 Got1/Sft2-like vescicle transp... Lus10025494 0 1
AT4G29890 choline monooxygenase, putativ... Lus10008571 9.7 0.9242
AT1G04970 lipid-binding serum glycoprote... Lus10033808 12.0 0.9265
AT3G22290 Endoplasmic reticulum vesicle ... Lus10023828 12.4 0.9223
AT5G01520 AtAIRP2, AIRP2 ABA Insensitive RING Protein 2... Lus10002491 15.0 0.9092
Lus10011267 15.1 0.9184
AT1G17455 ELF4-L4 ELF4-like 4 (.1.2) Lus10000408 22.4 0.9066
AT2G24240 BTB/POZ domain with WD40/YVTN ... Lus10036274 24.5 0.9194
AT1G08110 lactoylglutathione lyase famil... Lus10016138 25.6 0.9144
AT4G23980 ARF ARF9 auxin response factor 9 (.1.2) Lus10032414 25.7 0.9078
AT1G72510 Protein of unknown function (D... Lus10015670 26.5 0.9022

Lus10025494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.