Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72930 127 / 2e-37 TIR toll/interleukin-1 receptor-like (.1.2) AT5G36930 134 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 127 / 2e-36 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72950 127 / 3e-35 Disease resistance protein (TIR-NBS class) (.1) AT1G72940 125 / 8e-35 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G17615 122 / 1e-33 Disease resistance protein (TIR-NBS class) (.1) AT1G27180 125 / 2e-33 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G72910 121 / 5e-33 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G65850 124 / 7e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G63880 121 / 4e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020536 [exp] 249 / 6e-77 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10026961 [exp] 243 / 6e-75 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020533 [exp] 242 / 3e-74 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10020524 [exp] 241 / 5e-74 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10020534 [exp] 241 / 6e-74 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020537 [exp] 241 / 7e-74 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10001040 [exp] 219 / 2e-72 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008415 [exp] 213 / 4e-71 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008027 [exp] 213 / 2e-69 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G001314 [exp] 149 / 4e-45 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 151 / 2e-43 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 153 / 4e-43 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G037599 [exp] 152 / 7e-43 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 149 / 1e-42 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 148 / 3e-42 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 143 / 3e-42 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 150 / 4e-42 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 150 / 4e-42 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 150 / 5e-42 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10025497 pacid=23144987 polypeptide=Lus10025497 locus=Lus10025497.g ID=Lus10025497.BGIv1.0 annot-version=v1.0 ATGTCGAGTCCTGAAGAGTACCAGGTTTTCTTGAGCTTCAGAGGCCTTGATGTCCGCCGAACATTTGCTGACCATCTCCGCACTTGCCTTGTTCGTTCCA AAATTCGCACATTTGCCAACGACGAAGAGCTCCCAAAGGGGGAAGCCATCGGTCCGTCCCTTGTCAAAGCTATAACCGAGTCCAAGATCCTCATCGTGGT CTTATCCGAGAACTATGCTTTCAGCAAATGGTGCCTCCGGGAGCTAGCTACGGTGGTCGATTCCTACAAGACTGGAGGAGGAAAACAGATTATCCTACCT GTTTTCTACGGCATTGATCCGAAAGACGTCCGGCATCTAGATTCGGGTCCTTACAAGAAAGCATTTGAACAACACAGCCTGAAGCATGATCCTGAGACTG TAATGAAATGGAAGGAAGCACTGGGAGAGGTTGGCAGGACGAAAGGATGGCTCGTCACTGAATCGCATGGTCAGGGGGCTATAATAGACCATATCCTTAC TGAAGTGTTGTCACATCTGAAGGCGACTGTGGCAGAAGCATCAGTGGCCGGCCAGCAGCCTTGA
AA sequence Show only first row Show all	>Lus10025497 pacid=23144987 polypeptide=Lus10025497 locus=Lus10025497.g ID=Lus10025497.BGIv1.0 annot-version=v1.0 MSSPEEYQVFLSFRGLDVRRTFADHLRTCLVRSKIRTFANDEELPKGEAIGPSLVKAITESKILIVVLSENYAFSKWCLRELATVVDSYKTGGGKQIILP VFYGIDPKDVRHLDSGPYKKAFEQHSLKHDPETVMKWKEALGEVGRTKGWLVTESHGQGAIIDHILTEVLSHLKATVAEASVAGQQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10025497 [exp]	0	1
AT3G46440		UXS5	UDP-XYL synthase 5 (.1.2)		Lus10004951 [exp]	1.0	0.9015
AT1G01490			Heavy metal transport/detoxifi...		Lus10039285 [exp]	7.5	0.7040
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10027281 [exp]	9.6	0.7055
					Lus10037861 [exp]	14.6	0.6936
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10037952 [exp]	16.3	0.6936
					Lus10010826 [exp]	17.8	0.6936
					Lus10022108 [exp]	19.3	0.6936
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Lus10038862 [exp]	19.6	0.5825
AT2G36780			UDP-Glycosyltransferase superf...		Lus10023893 [exp]	20.6	0.6936
					Lus10003272 [exp]	21.8	0.6936

Compare expression of checked genes

Lus10025497 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.