Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026715 [exp] 80 / 3e-20 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025502 pacid=23145102 polypeptide=Lus10025502 locus=Lus10025502.g ID=Lus10025502.BGIv1.0 annot-version=v1.0 ATGGCCGATGGGATTGAGAAAGCTGCTGAATATTCCGAAACTCTCCTCAATAAGGTGGAAGAAATTGGAGACCAAGCTGAAGAGTTTGTGGAATCAGCCA TCTCCAAGAAACCAGCTACTACTACTGCTACTGCTGCTGCTACGACGGGTTTGCAGCAGTTGGCCCAAGAAGTTCAAGCTGAGATATAG
AA sequence Show only first row Show all	>Lus10025502 pacid=23145102 polypeptide=Lus10025502 locus=Lus10025502.g ID=Lus10025502.BGIv1.0 annot-version=v1.0 MADGIEKAAEYSETLLNKVEEIGDQAEEFVESAISKKPATTTATAAATTGLQQLAQEVQAEI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025502 [exp]	0	1
					Lus10025501 [exp]	1.0	0.9683
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10007248 [exp]	3.7	0.9569
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10006978 [exp]	4.9	0.9445
AT1G71740			unknown protein		Lus10042773 [exp]	6.6	0.9306
AT4G17486			PPPDE putative thiol peptidase...		Lus10013657 [exp]	7.0	0.9282
AT3G01980			NAD(P)-binding Rossmann-fold s...		Lus10041545 [exp]	7.2	0.9242
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10038260 [exp]	8.0	0.9280
AT3G53140			O-methyltransferase family pro...		Lus10023892 [exp]	8.1	0.9287
AT3G24020			Disease resistance-responsive ...		Lus10023689 [exp]	12.2	0.9266
AT1G32310			unknown protein		Lus10030955 [exp]	13.0	0.9170

Compare expression of checked genes

Lus10025502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.