Lus10025515 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G12890 99 / 1e-24 UDP-Glycosyltransferase superfamily protein (.1)
AT2G18570 87 / 1e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT2G18560 84 / 9e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT4G01070 85 / 1e-19 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
AT5G03490 82 / 6e-19 UDP-Glycosyltransferase superfamily protein (.1)
AT1G01420 82 / 9e-19 UGT72B3 UDP-glucosyl transferase 72B3 (.1)
AT1G10400 81 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1)
AT2G29710 81 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1)
AT3G50740 80 / 4e-18 UGT72E1 UDP-glucosyl transferase 72E1 (.1)
AT2G29730 80 / 4e-18 UGT71D1 UDP-glucosyl transferase 71D1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025513 146 / 7e-42 AT5G12890 348 / 9e-115 UDP-Glycosyltransferase superfamily protein (.1)
Lus10031819 108 / 5e-28 AT5G12890 506 / 4e-177 UDP-Glycosyltransferase superfamily protein (.1)
Lus10031248 105 / 6e-27 AT5G12890 512 / 2e-179 UDP-Glycosyltransferase superfamily protein (.1)
Lus10010476 87 / 2e-20 AT1G07250 342 / 7e-113 UDP-glucosyl transferase 71C4 (.1)
Lus10003805 86 / 8e-20 AT1G07250 332 / 5e-109 UDP-glucosyl transferase 71C4 (.1)
Lus10022221 83 / 5e-19 AT2G16890 479 / 1e-166 UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10022222 82 / 1e-18 AT5G14860 505 / 4e-177 UDP-Glycosyltransferase superfamily protein (.1)
Lus10001906 82 / 2e-18 AT4G01070 431 / 1e-147 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10029452 81 / 2e-18 AT4G01070 582 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G077500 139 / 2e-39 AT5G12890 389 / 9e-131 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G077400 134 / 2e-37 AT5G12890 381 / 1e-127 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G077800 134 / 2e-37 AT5G12890 387 / 3e-130 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G077700 121 / 5e-33 AT5G12890 332 / 1e-109 UDP-Glycosyltransferase superfamily protein (.1)
Potri.003G210400 109 / 1e-28 AT5G12890 525 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G016300 108 / 2e-28 AT5G12890 543 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G016500 95 / 3e-23 AT5G12890 525 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.014G041800 79 / 7e-18 AT4G01070 390 / 9e-132 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.018G009000 79 / 9e-18 AT2G15490 323 / 6e-106 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.007G030400 79 / 1e-17 AT3G50740 566 / 0.0 UDP-glucosyl transferase 72E1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10025515 pacid=23145063 polypeptide=Lus10025515 locus=Lus10025515.g ID=Lus10025515.BGIv1.0 annot-version=v1.0
ATGGCTGCCGGAAGGGTTCGAGCATCGAGTCCAACAATCCAAAACAGGACTACTGGTCCGGAACTGGGCCCCACAGTTGGAGATCCTGTCCCACAAGTCA
ACGAGAGCGTTCTGAGCCACTGCGGCTGGAACTCCGTACTAGAGAGCTTGAGCCAGGGGGTTCCCATCATCGCTTGGCCATTGGCGGCCGAGCAAGGTTT
CAATGCAAAGATGGTCAAGGAGGAGATCGGAGCAGCTGTGGAACTTTCGAGAGGAACGGAGAGTGTTCTTGAGAGAACTGAGGTTAAGAGAGTGATTGAG
TTTGTGATGGGGGAAGAAGGGGATGAATTGAAGAGGAAAGTTGAGGACGTTGCTCGGCATTTGCGGGCTTCGGTTCGAGATGAAGGGAATGATGATAAGA
AAGGTTCTTCTGTGAAAGCTATGGATGATTTCCTGCAAACAGTTCTGAGCAATCGAGCCCCAACAGAGTGA
AA sequence
>Lus10025515 pacid=23145063 polypeptide=Lus10025515 locus=Lus10025515.g ID=Lus10025515.BGIv1.0 annot-version=v1.0
MAAGRVRASSPTIQNRTTGPELGPTVGDPVPQVNESVLSHCGWNSVLESLSQGVPIIAWPLAAEQGFNAKMVKEEIGAAVELSRGTESVLERTEVKRVIE
FVMGEEGDELKRKVEDVARHLRASVRDEGNDDKKGSSVKAMDDFLQTVLSNRAPTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12890 UDP-Glycosyltransferase superf... Lus10025515 0 1
AT5G12890 UDP-Glycosyltransferase superf... Lus10025514 1.0 0.9818
AT1G03495 HXXXD-type acyl-transferase fa... Lus10029826 7.1 0.8582
Lus10024679 25.0 0.7489
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10019911 27.7 0.7451
AT4G38540 FAD/NAD(P)-binding oxidoreduct... Lus10019729 36.1 0.7898
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10018143 55.5 0.7614
AT5G38200 Class I glutamine amidotransfe... Lus10016700 73.8 0.7853
AT4G35150 O-methyltransferase family pro... Lus10012408 83.6 0.7193
AT2G37430 C2H2ZnF ZAT11 C2H2 and C2HC zinc fingers sup... Lus10040312 87.9 0.7520
AT2G24610 ATCNGC14 cyclic nucleotide-gated channe... Lus10020122 132.5 0.7386

Lus10025515 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.