Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43280 87 / 9e-23 FAR1_related Far-red impaired responsive (FAR1) family protein (.1) AT3G07500 52 / 3e-09 FAR1_related Far-red impaired responsive (FAR1) family protein (.1) AT4G38170 39 / 0.0002 FRS9 FAR1-related sequence 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026732 [exp] 109 / 4e-32 AT3G07500 88 / 2e-22 Far-red impaired responsive (FAR1) family protein (.1) Lus10022979 [exp] 45 / 1e-06 AT4G38180 85 / 8e-20 FAR1-related sequence 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G029400 [exp] 94 / 2e-25 AT2G43280 319 / 4e-112 Far-red impaired responsive (FAR1) family protein (.1) Potri.002G239400 [exp] 56 / 6e-11 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.002G239300 [exp] 55 / 3e-10 AT2G43280 130 / 2e-37 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G128800 [exp] 55 / 4e-10 AT3G07500 124 / 8e-35 Far-red impaired responsive (FAR1) family protein (.1) Potri.014G176600 [exp] 51 / 7e-09 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.014G176500 [exp] 50 / 1e-08 AT3G07500 275 / 2e-94 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G128900 [exp] 49 / 3e-08 AT3G07500 154 / 2e-46 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G128700 [exp] 49 / 4e-08 AT3G07500 138 / 2e-40 Far-red impaired responsive (FAR1) family protein (.1) Potri.011G145800 [exp] 41 / 3e-05 AT4G38180 1003 / 0.0 FAR1-related sequence 5 (.1) Potri.009G170100 [exp] 40 / 6e-05 AT4G38180 1145 / 0.0 FAR1-related sequence 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025517 pacid=23144960 polypeptide=Lus10025517 locus=Lus10025517.g ID=Lus10025517.BGIv1.0 annot-version=v1.0 ATGGTAACTGGAAGGACTAAAAGTGGATGTGAAGAAAATATAAACTACCCAGACATTGTCGTTGGCGAGGATTGGCCGTCGTTCAATCGAAAGGGTTTCC GCTTGCTGGATGAGAAGGACAAACAGATTCAAGCACTGACAATGGAGATACGGAACAAGAAGCGGTTATGCACCATGTATCAAGAACAGCTGGCAGCATT CATTAAGATAGTCGAAGAGCATAACGAGCAACTGTCAATGAAAGTTGAAAATGTAGTGAAAGATCTCAAAGAGGTTGAATCTATAGAGCAGCAGTAG
AA sequence Show only first row Show all	>Lus10025517 pacid=23144960 polypeptide=Lus10025517 locus=Lus10025517.g ID=Lus10025517.BGIv1.0 annot-version=v1.0 MVTGRTKSGCEENINYPDIVVGEDWPSFNRKGFRLLDEKDKQIQALTMEIRNKKRLCTMYQEQLAAFIKIVEEHNEQLSMKVENVVKDLKEVESIEQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43280	FAR1_related		Far-red impaired responsive (F...		Lus10025517 [exp]	0	1
AT5G08450			unknown protein		Lus10004298 [exp]	4.6	0.7813
AT3G27050			unknown protein		Lus10035208 [exp]	5.3	0.8105
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	8.6	0.8280
AT4G38495			unknown protein		Lus10029400 [exp]	17.2	0.7791
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10000920 [exp]	30.1	0.7939
					Lus10032317 [exp]	30.7	0.7630
AT5G19960			RNA-binding (RRM/RBD/RNP motif...		Lus10017757 [exp]	33.1	0.7809
AT1G73170			P-loop containing nucleoside t...		Lus10015985 [exp]	34.0	0.7654
AT2G39960			Microsomal signal peptidase 25...		Lus10014838 [exp]	35.7	0.7440
AT3G05400			Major facilitator superfamily ...		Lus10029970 [exp]	40.2	0.7647

Compare expression of checked genes

Lus10025517 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.