Lus10025532 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06710 113 / 4e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G20740 57 / 1e-09 EMB3131 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G22670 45 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G02060 42 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G71060 42 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G65820 42 / 0.0001 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G14080 41 / 0.0004 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G06400 40 / 0.0006 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G15010 40 / 0.0006 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G30290 40 / 0.001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026747 344 / 6e-112 AT1G06710 1190 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016361 56 / 4e-09 AT4G20740 914 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10019764 56 / 5e-09 AT4G20740 590 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10018567 48 / 2e-06 AT1G03560 862 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10021991 47 / 6e-06 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001633 46 / 9e-06 AT1G71060 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019141 44 / 5e-05 AT1G73400 672 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009626 43 / 0.0001 AT1G71210 649 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015741 43 / 0.0001 AT3G62470 725 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G123600 169 / 1e-48 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G203100 63 / 2e-11 AT4G20740 964 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.015G084800 49 / 5e-07 AT3G48250 715 / 0.0 Buthionine sulfoximine-insensitive roots 6, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G015900 48 / 1e-06 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G154901 46 / 6e-06 AT5G47360 429 / 4e-147 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G053600 44 / 5e-05 AT5G15010 659 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.019G103400 43 / 9e-05 AT1G03560 911 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.010G098600 42 / 0.0001 AT1G73400 670 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G090600 40 / 0.0006 AT5G08310 851 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10025532 pacid=23144970 polypeptide=Lus10025532 locus=Lus10025532.g ID=Lus10025532.BGIv1.0 annot-version=v1.0
ATGAGAAGGTGGGTTGCTAAGACTCTTCTTCAATCGCGTTCCCTTCCATTTCCAATCAGTCACTCGAAAACCAGGTTGCTCACAAGTTCTTCCTCCGACA
ATCTGGAAGGTTTGGTTGACCCGGATGACCTTTCTCTCTCAGGGCCAGAGTCAATTTCCAGTGAAGAGTTTACTCTTCTGCGGGATTCTTTATTGAACCC
TCATTCTTCTTCTTCTTCTTCTTCTTCTGCTGGTAAGTTCTCAGATGAAGCGTTGATGGTTGTTGATGTGATCTTGAGTGTTAATGATCAGTTTGGTAAA
GAAACCGTGAAGTTGCTCAGGCGGCATAGGGAGAAGTTAAGCGAGTCTTTGGTGATTGAGGTTCTGAATTTGCTCAATAGCCCTGAACTAGGTCTTAGAT
TCTTCATATGGGCTGGCCAGCAAATCGGATATTCCCACACTTTACCTGTGTACAATGCGCTACTAGAGTTGTTGCAGAGAAATAATAGTGCTGCTGGAGG
TAGAATACCAGAGCAGTTCCTGCTGCAAATCGAAGGTGGTAAGGTAGAATACCGGAGCAGCTCCTGCTGCAAATCGAAGGTGGTGATGACAAGGAAGTTC
TAG
AA sequence
>Lus10025532 pacid=23144970 polypeptide=Lus10025532 locus=Lus10025532.g ID=Lus10025532.BGIv1.0 annot-version=v1.0
MRRWVAKTLLQSRSLPFPISHSKTRLLTSSSSDNLEGLVDPDDLSLSGPESISSEEFTLLRDSLLNPHSSSSSSSSAGKFSDEALMVVDVILSVNDQFGK
ETVKLLRRHREKLSESLVIEVLNLLNSPELGLRFFIWAGQQIGYSHTLPVYNALLELLQRNNSAAGGRIPEQFLLQIEGGKVEYRSSSCCKSKVVMTRKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06710 Tetratricopeptide repeat (TPR)... Lus10025532 0 1
AT1G05830 SDG30, ATX2 SET DOMAIN PROTEIN 30, trithor... Lus10025508 9.7 0.8838
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10004303 12.5 0.8658
AT1G27590 unknown protein Lus10007229 17.1 0.8777
AT3G06530 ARM repeat superfamily protein... Lus10008676 19.1 0.8818
AT4G17610 tRNA/rRNA methyltransferase (S... Lus10011019 23.5 0.8731
AT1G26170 ARM repeat superfamily protein... Lus10031911 28.4 0.8774
AT1G33410 NUP160, SAR1, A... ARABIDOPSIS NUCLEOPORIN 160, S... Lus10038728 32.4 0.8714
AT5G51200 EMB3142 EMBRYO DEFECTIVE 3142, Protein... Lus10005726 36.5 0.8765
AT4G27010 EMB2788 EMBRYO DEFECTIVE 2788, unknown... Lus10012535 36.7 0.8608
AT5G48120 ARM repeat superfamily protein... Lus10011436 37.1 0.8620

Lus10025532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.