Lus10025539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032535 160 / 7e-51 ND /
Lus10033028 135 / 8e-40 ND /
Lus10021744 113 / 2e-32 ND /
Lus10010609 87 / 2e-21 ND /
Lus10003221 80 / 1e-19 ND /
Lus10012492 69 / 1e-14 ND /
Lus10039431 64 / 3e-13 ND /
Lus10012674 57 / 3e-11 ND /
Lus10030123 41 / 8e-05 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0274 WRKY-GCM1 PF03108 DBD_Tnp_Mut MuDR family transposase
Representative CDS sequence
>Lus10025539 pacid=23144988 polypeptide=Lus10025539 locus=Lus10025539.g ID=Lus10025539.BGIv1.0 annot-version=v1.0
ATGATTGTGGACCAATATGAGGGTGGTCTTAAAATTCCAAATTTTGACCCCACTCGTAAAGATTTCTACATCGGTCAACGGTTTTACACAAAGAAGGAGG
CAAGTCTTGCTGTCAAACACTGGGTCGTGCAGAACAATCGAGCTTTGGCGACCTCACGCACAAAGACTTGGGAGTTTGAGGTCAGGTGTTATTCGTACAA
AACCAACAATTGTCCATGGAGGTTACGCGTCTCGACCAGAGCGGATGACGGGTTCTGGACGGTTCGGCAGTGGAATCCACATCACACATGTGACGGAAGG
ACGGGTTCTGGACCGCTACACGGTCATTTGATAATAATCGTTGGATCAACACCTATAGTGCGTCATGCGTTCTATGATGCACCGCGCACTGTAGGTGTAA
CGTTTCTACTTGATTGTATAAGTAATTTTTTATTAAATCCCGTCTAA
AA sequence
>Lus10025539 pacid=23144988 polypeptide=Lus10025539 locus=Lus10025539.g ID=Lus10025539.BGIv1.0 annot-version=v1.0
MIVDQYEGGLKIPNFDPTRKDFYIGQRFYTKKEASLAVKHWVVQNNRALATSRTKTWEFEVRCYSYKTNNCPWRLRVSTRADDGFWTVRQWNPHHTCDGR
TGSGPLHGHLIIIVGSTPIVRHAFYDAPRTVGVTFLLDCISNFLLNPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025539 0 1
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10023036 4.5 0.6781
AT1G06340 Plant Tudor-like protein (.1) Lus10039027 6.3 0.6781
AT5G36220 CYP91A1, CYP81D... CYTOCHROME P450 91A1, cytochro... Lus10018718 7.7 0.6781
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Lus10026169 8.9 0.6781
AT2G44220 Protein of Unknown Function (D... Lus10006862 10.0 0.6781
Lus10033149 18.5 0.6492
AT4G26466 LRE lorelei (.1) Lus10011066 19.9 0.6164
AT3G16180 Major facilitator superfamily ... Lus10009506 20.0 0.6492
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 21.4 0.6492
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 22.6 0.6492

Lus10025539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.