Lus10025542 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31710 165 / 3e-48 Copper amine oxidase family protein (.1)
AT1G31690 159 / 4e-46 Copper amine oxidase family protein (.1)
AT1G31670 153 / 1e-43 Copper amine oxidase family protein (.1)
AT4G12270 124 / 7e-34 Copper amine oxidase family protein (.1)
AT1G62810 125 / 8e-34 Copper amine oxidase family protein (.1)
AT4G12290 124 / 3e-33 Copper amine oxidase family protein (.1)
AT4G14940 114 / 5e-30 ATAO1 amine oxidase 1 (.1)
AT3G43670 112 / 3e-29 Copper amine oxidase family protein (.1)
AT2G42490 64 / 3e-12 Copper amine oxidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026757 274 / 4e-89 AT1G31690 727 / 0.0 Copper amine oxidase family protein (.1)
Lus10010540 177 / 2e-52 AT1G31710 761 / 0.0 Copper amine oxidase family protein (.1)
Lus10004912 151 / 4e-43 AT1G31710 738 / 0.0 Copper amine oxidase family protein (.1)
Lus10010542 144 / 3e-40 AT1G31710 753 / 0.0 Copper amine oxidase family protein (.1)
Lus10013355 124 / 2e-35 AT1G31710 224 / 2e-68 Copper amine oxidase family protein (.1)
Lus10024571 126 / 4e-34 AT4G12290 993 / 0.0 Copper amine oxidase family protein (.1)
Lus10024568 125 / 9e-34 AT1G62810 914 / 0.0 Copper amine oxidase family protein (.1)
Lus10021922 124 / 3e-33 AT4G14940 839 / 0.0 amine oxidase 1 (.1)
Lus10032209 122 / 2e-32 AT4G12290 996 / 0.0 Copper amine oxidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089050 174 / 2e-51 AT1G31710 780 / 0.0 Copper amine oxidase family protein (.1)
Potri.008G151900 160 / 3e-46 AT1G31690 793 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088800 155 / 2e-44 AT1G31710 782 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088900 129 / 3e-35 AT4G14940 904 / 0.0 amine oxidase 1 (.1)
Potri.001G118200 124 / 2e-33 AT1G62810 961 / 0.0 Copper amine oxidase family protein (.1)
Potri.001G118300 123 / 6e-33 AT4G12290 1060 / 0.0 Copper amine oxidase family protein (.1)
Potri.012G084400 71 / 8e-15 AT2G42490 1250 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G045600 67 / 1e-13 AT2G42490 1202 / 0.0 Copper amine oxidase family protein (.1)
Potri.015G082900 66 / 6e-13 AT2G42490 1256 / 0.0 Copper amine oxidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0103 Gal_mutarotase PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain
Representative CDS sequence
>Lus10025542 pacid=23145054 polypeptide=Lus10025542 locus=Lus10025542.g ID=Lus10025542.BGIv1.0 annot-version=v1.0
ATGCTGCCATTAGAAGGGATCACGATGGTGGTTGACTTGGATGAGATGAGGATTGTGGAGTACGGCAATAAGAACGGAGCTCCGATGCCGAAAGCTTCCG
GGACGGATTATAGGCTGACGGAGATGGATCCGCCGCTAGGACCCAGGCTTAACGGTGTCGTTTTGCTTCAGCCTGATGGTCCAGGTTTCGCCGTCGATGG
ACATTCCGTCAGTTGGGTAGATTGGGTTTCGTTCGATGCCCGGCTCGGTTTGATGATATCCACAACTCAGATTTACGACCCGAAACTCGAATCGTACCGG
AGTGTCCTCTACAGAGGGTACATGTCCGAGATATTCGGGCCCTACATGGATCCAAGGGTCAATCACTACTTTAAGTCGTACCTCCACGTGGGCGAGTACG
GGTTCGGTCTATGCACGGTTCCATTGGTCCGGGCGTCAATTGTCCGGAAAATGCAGAGTTCATGGACGGGTACATCGGAGGAATCAACGGCTCGCCCGTG
A
AA sequence
>Lus10025542 pacid=23145054 polypeptide=Lus10025542 locus=Lus10025542.g ID=Lus10025542.BGIv1.0 annot-version=v1.0
MLPLEGITMVVDLDEMRIVEYGNKNGAPMPKASGTDYRLTEMDPPLGPRLNGVVLLQPDGPGFAVDGHSVSWVDWVSFDARLGLMISTTQIYDPKLESYR
SVLYRGYMSEIFGPYMDPRVNHYFKSYLHVGEYGFGLCTVPLVRASIVRKMQSSWTGTSEESTARP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31710 Copper amine oxidase family pr... Lus10025542 0 1

Lus10025542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.