Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20660 128 / 3e-36 4-Oct, ATOCT4 organic cation/carnitine transporter4 (.1) AT1G73220 50 / 3e-08 1-Oct, ATOCT1 organic cation/carnitine transporter1 (.1) AT1G79410 39 / 0.0001 5-Oct, ATOCT5 organic cation/carnitine transporter5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014801 [exp] 129 / 1e-36 AT3G20660 704 / 0.0 organic cation/carnitine transporter4 (.1) Lus10013330 [exp] 106 / 3e-28 AT3G20660 611 / 0.0 organic cation/carnitine transporter4 (.1) Lus10005217 [exp] 82 / 1e-19 AT3G20660 221 / 2e-76 organic cation/carnitine transporter4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130533 [exp] 141 / 5e-41 AT3G20660 708 / 0.0 organic cation/carnitine transporter4 (.1) Potri.015G029400 [exp] 52 / 4e-09 AT1G73220 519 / 1e-180 organic cation/carnitine transporter1 (.1) Potri.012G037400 [exp] 52 / 4e-09 AT1G73220 473 / 1e-162 organic cation/carnitine transporter1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025543 pacid=23145122 polypeptide=Lus10025543 locus=Lus10025543.g ID=Lus10025543.BGIv1.0 annot-version=v1.0 ATGGAATGCAGTGTATTAGGCATATTCGGCATGGCTGGGACGTACAATTTGTTGTTTATCTACGTCGCGGAGCTTTTCCCCACGGTCGTGTTAGGTTGCG CGGCACAAGCAACACAACTCGCTGCAATCCTGGTACCTTTCGTCGTGGTTTTGGGCGGTTCGCTACCGTTAGTGATCTTTGCGGCGTGTGGGTTCGTGGG AGCATTGATGTGCCTGTTCTTGCCCGATACATTGAATCAGCCAATGTATGACGCTATAGTGGGGATGAAGGAAGGGCAACGTGCTAAAAATGATGTTGAT GTGGCTTGA
AA sequence Show only first row Show all	>Lus10025543 pacid=23145122 polypeptide=Lus10025543 locus=Lus10025543.g ID=Lus10025543.BGIv1.0 annot-version=v1.0 MECSVLGIFGMAGTYNLLFIYVAELFPTVVLGCAAQATQLAAILVPFVVVLGGSLPLVIFAACGFVGALMCLFLPDTLNQPMYDAIVGMKEGQRAKNDVD VA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20660		4-Oct, ATOCT4	organic cation/carnitine trans...		Lus10025543 [exp]	0	1

Compare expression of checked genes

Lus10025543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.