Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27080 107 / 1e-29 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT5G21130 96 / 5e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 47 / 2e-07 NHL3 NDR1/HIN1-like 3 (.1) AT2G27260 42 / 1e-05 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 39 / 0.0002 NHL2 NDR1/HIN1-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026762 [exp] 226 / 3e-78 AT2G27080 110 / 5e-31 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Lus10031317 [exp] 56 / 2e-10 AT1G54540 231 / 1e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031888 [exp] 54 / 9e-10 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 50 / 3e-08 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 49 / 7e-08 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10000688 [exp] 41 / 5e-05 AT2G22180 98 / 1e-23 hydroxyproline-rich glycoprotein family protein (.1) Lus10016800 [exp] 40 / 0.0001 AT2G22180 88 / 4e-20 hydroxyproline-rich glycoprotein family protein (.1) Lus10019667 [exp] 38 / 0.0007 AT2G22180 102 / 3e-25 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G197600 [exp] 124 / 5e-36 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.009G158900 [exp] 121 / 4e-35 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.005G166600 [exp] 66 / 3e-14 AT2G27080 114 / 2e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.015G148200 [exp] 52 / 8e-09 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.017G154000 [exp] 50 / 2e-08 AT1G54540 242 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G067100 [exp] 42 / 1e-05 AT1G54540 203 / 3e-65 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 40 / 6e-05 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.005G077100 [exp] 40 / 0.0001 AT2G22180 111 / 8e-29 hydroxyproline-rich glycoprotein family protein (.1) Potri.013G135800 [exp] 39 / 0.0002 AT1G65690 112 / 4e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.018G052500 [exp] 39 / 0.0004 AT5G11890 198 / 3e-62 EMBRYO DEFECTIVE 3135, unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03168 [flax] [poplar] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10025548 pacid=23145078 polypeptide=Lus10025548 locus=Lus10025548.g ID=Lus10025548.BGIv1.0 annot-version=v1.0 ATGGAGATGCTTTATCGGGCGGGGAGCTCCGCCGCCGTGTACTACAACGGGATCGAGTTGGGGACCGGTTCGGTTCCGGTTTTCGAACAGGGCAAGAATC AGGTGACGACGTTTGCGGCGGCGTTGAAAGGGAACGGGATTCTGTTGACGGGAGCCGTGCAACGGTCGTTGAAGGGTGCGGCGTCGTTTAAGCTGGACAT GAGGGCTCCCGTTAAGTTTAGGTTAGGTGGGGTGAACTCGTGGACGTTTACTGCTAAAGTTGACTGTGATATCACGGTGGATAATTTGACGGCGAATGCT ACCGTCGTTTCGCAGCAATGTGGTTACGACGTCGACGTTTGGTAG
AA sequence Show only first row Show all	>Lus10025548 pacid=23145078 polypeptide=Lus10025548 locus=Lus10025548.g ID=Lus10025548.BGIv1.0 annot-version=v1.0 MEMLYRAGSSAAVYYNGIELGTGSVPVFEQGKNQVTTFAAALKGNGILLTGAVQRSLKGAASFKLDMRAPVKFRLGGVNSWTFTAKVDCDITVDNLTANA TVVSQQCGYDVDVW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27080			Late embryogenesis abundant (L...		Lus10025548 [exp]	0	1
AT5G06990			Protein of unknown function, D...		Lus10008672 [exp]	2.8	0.6975
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10004984 [exp]	8.2	0.7385
AT4G35150			O-methyltransferase family pro...		Lus10012408 [exp]	13.6	0.7167
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014689 [exp]	15.2	0.7305
AT5G44700		GSO2, EDA23	GASSHO 2, EMBRYO SAC DEVELOPME...		Lus10039958 [exp]	18.4	0.6631
AT2G27080			Late embryogenesis abundant (L...		Lus10026762 [exp]	24.4	0.7351
AT3G53170			Tetratricopeptide repeat (TPR)...		Lus10024144 [exp]	26.5	0.6536
					Lus10011276 [exp]	27.7	0.6755
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10032323 [exp]	30.2	0.6546
AT3G22060			Receptor-like protein kinase-r...		Lus10039699 [exp]	31.5	0.6977

Compare expression of checked genes

Lus10025548 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.