Lus10025585 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30710 111 / 1e-29 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019370 120 / 1e-33 AT2G30710 568 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Lus10008148 122 / 3e-33 AT2G30710 625 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Lus10027046 134 / 7e-06 AT2G30710 526 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G134200 125 / 9e-35 AT2G30710 692 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Representative CDS sequence
>Lus10025585 pacid=23145106 polypeptide=Lus10025585 locus=Lus10025585.g ID=Lus10025585.BGIv1.0 annot-version=v1.0
ATGAGTCCCATCGATTCCATGGTTGAGATTCCATCAAGACAAGGTCAGAAGATGCCTGTAATGGGACCCACAACTGCTAATTCAGCCAGAGCTTGGGGTG
GTGCACCAACATACATGCGCCCTGATATTTGGACACTTCTCTTAGGCGATTCGGCATCCGGCAAGCCGGTATGTTCAAGGGATCAACGATCTGGTGACGC
CATTTCTGGTGGTTTTCTGGTGGTTTTCTTGTCTGAACACTTGGAAGGTGAAATAGAGGACTGGTGTATTTCGGATCTGCCACCAAACAAGATACTTGAC
ATTGAAGCAGATTGCTACTGGTGCCTCTCCAAGTTGCTCCATGGCATGCAAGACCACTACACTTTTGCTCAGCCTGGAATCCAGAGGCTTGTTTTTAAGC
TCAAGGAGTTGGCTAGCGCTACGGTAGCTACACTAAAACGTCAAGGGAATTAA
AA sequence
>Lus10025585 pacid=23145106 polypeptide=Lus10025585 locus=Lus10025585.g ID=Lus10025585.BGIv1.0 annot-version=v1.0
MSPIDSMVEIPSRQGQKMPVMGPTTANSARAWGGAPTYMRPDIWTLLLGDSASGKPVCSRDQRSGDAISGGFLVVFLSEHLEGEIEDWCISDLPPNKILD
IEADCYWCLSKLLHGMQDHYTFAQPGIQRLVFKLKELASATVATLKRQGN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30710 Ypt/Rab-GAP domain of gyp1p su... Lus10025585 0 1
Lus10005514 4.7 0.9739
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10031978 4.8 0.9496
AT5G27260 unknown protein Lus10007175 6.6 0.9739
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10017015 8.1 0.9739
AT3G60730 Plant invertase/pectin methyle... Lus10015877 9.4 0.9739
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10016888 10.5 0.9739
AT4G27570 UDP-Glycosyltransferase superf... Lus10027483 10.5 0.7154
Lus10022658 11.0 0.6995
AT1G61320 FBD / Leucine Rich Repeat doma... Lus10010664 11.5 0.9739
AT5G05070 DHHC-type zinc finger family p... Lus10027274 12.4 0.9739

Lus10025585 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.