Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34620 137 / 2e-43 SSR16 small subunit ribosomal protein 16 (.1) AT5G56940 133 / 2e-41 Ribosomal protein S16 family protein (.1) ATCG00050 48 / 2e-08 ATCG00050.1, RPS16 ribosomal protein S16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027058 [exp] 211 / 5e-73 AT4G34620 136 / 4e-43 small subunit ribosomal protein 16 (.1) Lus10014281 [exp] 133 / 2e-41 AT5G56940 210 / 2e-71 Ribosomal protein S16 family protein (.1) Lus10025984 [exp] 132 / 4e-41 AT5G56940 208 / 1e-70 Ribosomal protein S16 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G128200 [exp] 148 / 7e-48 AT4G34620 139 / 6e-44 small subunit ribosomal protein 16 (.1) Potri.004G217400 [exp] 136 / 7e-43 AT5G56940 188 / 7e-63 Ribosomal protein S16 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00886 [flax] [poplar] Ribosomal_S16 Ribosomal protein S16
Representative CDS sequence Show only first row Show all	>Lus10025592 pacid=23144945 polypeptide=Lus10025592 locus=Lus10025592.g ID=Lus10025592.BGIv1.0 annot-version=v1.0 ATGGCAGTGAAGATACGATTTGCAAGGCACGGTTGCACCCACAGGCCTTTCTACAGGATTGTTGTTGCTAATAGCCAATCCCCTCGCGACGGGAAGTTTA TTCAGATTATTGGTTTCTACGATCCCTTGGCTGCAAAGGATGACACCAAGAAGATGGGTCTCAATTATGACAGAGCCAAGTATTGGCTATCTGTAGGGGC GCAGCCTTCAGATACAGTTCGACGCATCCTTATGCAAGCAGGTCTGATCGAGCCACCACCGATGGTGGTAATGGCAAACAAGGATGGGAACAAGGATGAA GCTTGA
AA sequence Show only first row Show all	>Lus10025592 pacid=23144945 polypeptide=Lus10025592 locus=Lus10025592.g ID=Lus10025592.BGIv1.0 annot-version=v1.0 MAVKIRFARHGCTHRPFYRIVVANSQSPRDGKFIQIIGFYDPLAAKDDTKKMGLNYDRAKYWLSVGAQPSDTVRRILMQAGLIEPPPMVVMANKDGNKDE A

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34620		SSR16	small subunit ribosomal protei...		Lus10025592 [exp]	0	1
AT1G75350		EMB2184	embryo defective 2184, Ribosom...		Lus10010639 [exp]	1.7	0.9867
AT4G34620		SSR16	small subunit ribosomal protei...		Lus10027058 [exp]	2.4	0.9844
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Lus10011151 [exp]	2.4	0.9726
AT5G54600			Translation protein SH3-like f...		Lus10005180 [exp]	5.7	0.9742
AT1G75350		EMB2184	embryo defective 2184, Ribosom...		Lus10033200 [exp]	6.3	0.9734
AT5G14910			Heavy metal transport/detoxifi...		Lus10014520 [exp]	7.1	0.9730
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Lus10013041 [exp]	7.5	0.9696
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Lus10029120 [exp]	10.6	0.9722
AT1G68590			Ribosomal protein PSRP-3/Ycf65...		Lus10041469 [exp]	11.0	0.9635
AT3G14110		FLU	FLUORESCENT IN BLUE LIGHT, Tet...		Lus10008131 [exp]	11.7	0.9489

Compare expression of checked genes

Lus10025592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.