Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56280 72 / 9e-17 CSN6A COP9 signalosome subunit 6A (.1) AT4G26430 68 / 3e-15 CSN6B COP9 signalosome subunit 6B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027082 [exp] 116 / 4e-33 AT5G56280 527 / 0.0 COP9 signalosome subunit 6A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G169900 [exp] 71 / 3e-16 AT5G56280 511 / 0.0 COP9 signalosome subunit 6A (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025606 pacid=23145057 polypeptide=Lus10025606 locus=Lus10025606.g ID=Lus10025606.BGIv1.0 annot-version=v1.0 ATGGCGTCGTCGTCAAGCAGCGGACTAACTTTCAAGCTTCACCCACTAGTGATCGTTAACGTCTCCGATCATTACACTCGTGTCAAGTCTCAGGCAAACC CTCCTGCCCTCCCCAGCACAAGTGGCACCAACGGCTGCGGCGGAGATTCCGCTACCGCTTCCGCCACGGCTTCCACTGAACCGCCGCCGAGAGGCTATGG CTTTGTTCAACTCCTAGGGTTTCTATTCCGTGTATGA
AA sequence Show only first row Show all	>Lus10025606 pacid=23145057 polypeptide=Lus10025606 locus=Lus10025606.g ID=Lus10025606.BGIv1.0 annot-version=v1.0 MASSSSSGLTFKLHPLVIVNVSDHYTRVKSQANPPALPSTSGTNGCGGDSATASATASTEPPPRGYGFVQLLGFLFRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26430		CSN6B	COP9 signalosome subunit 6B (....		Lus10025606 [exp]	0	1
AT4G24630			DHHC-type zinc finger family p...		Lus10028737 [exp]	4.9	0.7849
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10030858 [exp]	10.9	0.8080
AT3G15010			RNA-binding (RRM/RBD/RNP motif...		Lus10025418 [exp]	15.6	0.7982
AT2G18220			Noc2p family (.1)		Lus10025551 [exp]	21.3	0.7728
AT3G43590			zinc knuckle (CCHC-type) famil...		Lus10013378 [exp]	21.8	0.7852
AT2G27100	C2H2ZnF	SE	C2H2 zinc-finger protein SERRA...		Lus10026766 [exp]	29.5	0.7843
AT2G27040		OCP11, AGO4	OVEREXPRESSOR OF CATIONIC PERO...		Lus10000295 [exp]	29.6	0.7067
AT3G15380			Plasma-membrane choline transp...		Lus10036620 [exp]	31.7	0.7803
AT1G17370		UBP1B	oligouridylate binding protein...		Lus10008130 [exp]	45.2	0.7593
AT3G01820			P-loop containing nucleoside t...		Lus10022342 [exp]	49.5	0.6852

Compare expression of checked genes

Lus10025606 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.