Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22140 54 / 2e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028077 [exp] 92 / 2e-26 AT1G22140 67 / 3e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G167200 [exp] 72 / 2e-18 AT1G22140 60 / 9e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025627 pacid=23145069 polypeptide=Lus10025627 locus=Lus10025627.g ID=Lus10025627.BGIv1.0 annot-version=v1.0 ATGGGAGAGCAACCAACGCATGTAACGGAGCAGCCAACAGGAAACACTGTGACTCAGGCACAGTTCCTCTCCTGGAAGCGGCGGAAGGATGAGGATGCCT TGGCTACGAGAGAAGCAGCTGCTAGGAAGCGTGCGGAAGATATAGCTGCAGGAATAGTGCAAAGGAATGGGCGTGAACTTTTCATTGATGAACCTTGGGT CTTCGATAACACTCAATACTAG
AA sequence Show only first row Show all	>Lus10025627 pacid=23145069 polypeptide=Lus10025627 locus=Lus10025627.g ID=Lus10025627.BGIv1.0 annot-version=v1.0 MGEQPTHVTEQPTGNTVTQAQFLSWKRRKDEDALATREAAARKRAEDIAAGIVQRNGRELFIDEPWVFDNTQY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22140			unknown protein		Lus10025627 [exp]	0	1
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10005077 [exp]	1.0	0.8955
AT2G37060	CCAAT	NF-YB8	"nuclear factor Y, subunit B8"...		Lus10023484 [exp]	1.4	0.8784
AT5G55140			ribosomal protein L30 family p...		Lus10031912 [exp]	4.0	0.8754
AT5G03430			phosphoadenosine phosphosulfat...		Lus10026539 [exp]	4.6	0.8720
AT2G18465			Chaperone DnaJ-domain superfam...		Lus10020871 [exp]	5.3	0.8441
AT1G67620			Lojap-related protein (.1)		Lus10036979 [exp]	5.7	0.8416
AT5G10700			Peptidyl-tRNA hydrolase II (PT...		Lus10020143 [exp]	5.9	0.8731
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030906 [exp]	6.9	0.8766
AT4G14965		ATMAPR4	membrane-associated progestero...		Lus10042022 [exp]	8.1	0.8723
AT5G09225			unknown protein		Lus10020870 [exp]	11.5	0.8324

Compare expression of checked genes

Lus10025627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.