Lus10025644 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G44760 166 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT2G03720 69 / 1e-14 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 64 / 1e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G03290 63 / 6e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G17390 61 / 2e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT4G13450 47 / 9e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018190 207 / 6e-69 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 168 / 4e-53 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 165 / 7e-52 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10019173 82 / 5e-19 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10007982 61 / 2e-11 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10034661 56 / 1e-09 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10036814 53 / 2e-09 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 42 / 3e-05 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014459 43 / 4e-05 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G177100 156 / 3e-48 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 154 / 4e-47 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.008G109000 83 / 2e-19 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 82 / 5e-19 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.010G140200 78 / 1e-17 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 72 / 2e-15 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G064800 44 / 1e-05 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10025644 pacid=23145002 polypeptide=Lus10025644 locus=Lus10025644.g ID=Lus10025644.BGIv1.0 annot-version=v1.0
ATGCAAGCTTCAGCTTCATTTCTCAGACAAGCGAGTAACAACAACAAGAGTGCCAACTCTAATTATTGCTCCACCATGGATGGAATGAGGAGGAAGAGGG
TTATGGTGATTGTGGATGAGACTTCACATTCAAAGCATGCTTTGATTTGGGCACTTACTCATCTGGTTAATCAGTTTGATTTGCTCACTCTGCTTCATAT
AATCCCCTCTTCTTCTTATTCTTCTTCTTCTTTGATTGTTGATTCCCTTGGTTCCCTCTGCAAATCCTGCAAGCCGGAGGTGGAAGTTGAGGCATTGGTG
GTGCAAGGGCCAAAGTTGGGGACAGTGATTAGCCAAGTGAAGAAGCTTGATGTTTCTGTTCTTGTTCTTGGTCACAAGAAGTCCTCTTCCTTTGCCACTT
GCCTATGTGGAAGCAGCAGCAGTAACAGTGAAGAGTTGGTGGAAGAGTGCATAATGAGTGTGGAGAGGTGCATGGTAGTTGGGGTGAGGAAGCAGAGCAA
AGGCAAGAGTGGCTATCTCATCACCACCAAATGGCAGAAGAACTTCTGGCTCTTGGCTTAA
AA sequence
>Lus10025644 pacid=23145002 polypeptide=Lus10025644 locus=Lus10025644.g ID=Lus10025644.BGIv1.0 annot-version=v1.0
MQASASFLRQASNNNKSANSNYCSTMDGMRRKRVMVIVDETSHSKHALIWALTHLVNQFDLLTLLHIIPSSSYSSSSLIVDSLGSLCKSCKPEVEVEALV
VQGPKLGTVISQVKKLDVSVLVLGHKKSSSFATCLCGSSSSNSEELVEECIMSVERCMVVGVRKQSKGKSGYLITTKWQKNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G44760 Adenine nucleotide alpha hydro... Lus10025644 0 1
AT3G46170 NAD(P)-binding Rossmann-fold s... Lus10006696 7.7 0.8682
AT2G28560 ATRAD51B, RAD51... DNA repair (Rad51) family prot... Lus10023341 9.2 0.8766
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Lus10023627 10.2 0.8286
AT4G22990 Major Facilitator Superfamily ... Lus10015852 10.2 0.8806
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10026819 11.0 0.8240
AT3G19200 unknown protein Lus10019867 11.7 0.8827
Lus10002087 12.4 0.8823
AT1G07290 GONST2 golgi nucleotide sugar transpo... Lus10005865 16.4 0.8615
AT1G05030 Major facilitator superfamily ... Lus10030010 17.7 0.8739
AT3G05390 unknown protein Lus10004494 19.8 0.8739

Lus10025644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.