Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02340 57 / 4e-11 ATPP2-B8 phloem protein 2-B8 (.1) AT2G02230 56 / 1e-10 ATPP2-B1 phloem protein 2-B1 (.1) AT2G02320 55 / 2e-10 ATPP2-B7 phloem protein 2-B7 (.1) AT5G24560 53 / 1e-09 ATPP2-B12 phloem protein 2-B12 (.1) AT2G02240 52 / 3e-09 MEE66 maternal effect embryo arrest 66, F-box family protein (.1) AT3G61060 51 / 7e-09 ATPP2-A13 phloem protein 2-A13 (.1.2) AT2G02250 50 / 1e-08 ATPP2-B2 phloem protein 2-B2 (.1) AT2G02360 49 / 3e-08 ATPP2-B10 phloem protein 2-B10 (.1) AT1G80110 49 / 5e-08 ATPP2-B11 phloem protein 2-B11 (.1) AT2G02310 49 / 6e-08 ATPP2-B6 phloem protein 2-B6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018175 [exp] 99 / 2e-28 AT2G02340 75 / 2e-17 phloem protein 2-B8 (.1) Lus10025661 [exp] 99 / 2e-26 AT2G02340 109 / 7e-28 phloem protein 2-B8 (.1) Lus10025660 [exp] 84 / 5e-21 AT2G02360 183 / 9e-57 phloem protein 2-B10 (.1) Lus10042712 [exp] 73 / 6e-17 AT2G02230 179 / 6e-55 phloem protein 2-B1 (.1) Lus10029673 [exp] 72 / 2e-16 AT2G02230 180 / 4e-55 phloem protein 2-B1 (.1) Lus10018171 [exp] 65 / 1e-13 AT2G02240 219 / 2e-69 maternal effect embryo arrest 66, F-box family protein (.1) Lus10025666 [exp] 65 / 1e-13 AT5G24560 219 / 5e-69 phloem protein 2-B12 (.1) Lus10020674 [exp] 51 / 8e-09 AT1G09155 266 / 7e-89 phloem protein 2-B15 (.1) Lus10029593 [exp] 49 / 5e-08 AT1G12710 398 / 2e-140 phloem protein 2-A12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G267000 [exp] 56 / 2e-10 AT2G02240 239 / 1e-77 maternal effect embryo arrest 66, F-box family protein (.1) Potri.001G109800 [exp] 55 / 3e-10 AT1G12710 408 / 1e-144 phloem protein 2-A12 (.1) Potri.003G121900 [exp] 53 / 1e-09 AT1G12710 401 / 9e-142 phloem protein 2-A12 (.1) Potri.018G015800 [exp] 52 / 3e-09 AT2G02240 242 / 1e-78 maternal effect embryo arrest 66, F-box family protein (.1) Potri.015G138600 [exp] 51 / 7e-09 AT5G52120 356 / 3e-124 phloem protein 2-A14 (.1) Potri.013G012600 [exp] 51 / 7e-09 AT1G09155 281 / 1e-94 phloem protein 2-B15 (.1) Potri.005G022000 [exp] 51 / 8e-09 AT1G09155 290 / 4e-98 phloem protein 2-B15 (.1) Potri.018G016100 [exp] 50 / 1e-08 AT2G02250 217 / 2e-69 phloem protein 2-B2 (.1) Potri.001G050100 [exp] 46 / 3e-07 AT2G02360 219 / 5e-71 phloem protein 2-B10 (.1) Potri.012G136200 [exp] 46 / 4e-07 AT5G52120 353 / 3e-123 phloem protein 2-A14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10025662 pacid=23145009 polypeptide=Lus10025662 locus=Lus10025662.g ID=Lus10025662.BGIv1.0 annot-version=v1.0 ATGGATGAATTGCCGGAGGAATGCGTGGAAAAGGTGATGTCGTATCTCGGACCTGAGCAGACTTGCAGGCTGGCTGTCCTCTCGAAAACGCTATGGTCGG CTTCGCAATCGGAACAACTCTGGCAAAGCTTCCTTCCGATCGGTTACCGGACGGTGATCTCGCGGTCGTCCTCAACTCTTGAGGGCATCAGTTACCGGTC GGTACTGATCTCAAGAATCTTCTTCAGGGCATCAGTACTCGAGAGCTTGTTCGCCGACTCTGCCAACGCCCAATTCTAA
AA sequence Show only first row Show all	>Lus10025662 pacid=23145009 polypeptide=Lus10025662 locus=Lus10025662.g ID=Lus10025662.BGIv1.0 annot-version=v1.0 MDELPEECVEKVMSYLGPEQTCRLAVLSKTLWSASQSEQLWQSFLPIGYRTVISRSSSTLEGISYRSVLISRIFFRASVLESLFADSANAQF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10025662 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000558 [exp]	3.0	1.0000
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	4.2	1.0000
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Lus10026679 [exp]	4.9	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	5.2	1.0000
					Lus10011636 [exp]	6.0	1.0000
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	6.7	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	7.3	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	7.9	1.0000
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	8.5	1.0000
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	9.0	1.0000

Compare expression of checked genes

Lus10025662 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.