Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21770 139 / 3e-44 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT1G77540 133 / 1e-41 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018168 [exp] 172 / 5e-57 AT1G21770 110 / 2e-32 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G178501 [exp] 148 / 1e-47 AT1G21770 145 / 2e-46 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025670 pacid=23145121 polypeptide=Lus10025670 locus=Lus10025670.g ID=Lus10025670.BGIv1.0 annot-version=v1.0 ATGGCGGCATCGACGGCGGCGATCGGAGAAGGGAAGACGGAGACGCCGAAGATAGTGCACAACGAGAAGGAAAGGAAGTTCGAGACGGAGGATAAGAAGG CTTACCTACAGTACGTGATGAGGGAAGGAGGTAGAGTTATGGATATCGTTCATACCTTCGTCCCTTCTTCCAAGCGAGGTCTAGGCATGGCTTCTCATCT CTGCACCGCCGCCTTCCAACACGCCGGATCCAATTCCATCTCCGTCATCCCCACTTGTTCCTACGTCTCCGACACGTTTCTTGTTCGGAATCCATCCTGG AAATCGATTGTGTACTCAGCGGATCAGAGATCCAACATATAG
AA sequence Show only first row Show all	>Lus10025670 pacid=23145121 polypeptide=Lus10025670 locus=Lus10025670.g ID=Lus10025670.BGIv1.0 annot-version=v1.0 MAASTAAIGEGKTETPKIVHNEKERKFETEDKKAYLQYVMREGGRVMDIVHTFVPSSKRGLGMASHLCTAAFQHAGSNSISVIPTCSYVSDTFLVRNPSW KSIVYSADQRSNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21770			Acyl-CoA N-acyltransferases (N...		Lus10025670 [exp]	0	1
AT5G61510			GroES-like zinc-binding alcoho...		Lus10009658 [exp]	4.2	0.9270
AT4G21580			oxidoreductase, zinc-binding d...		Lus10011233 [exp]	4.2	0.9124
AT1G04850			ubiquitin-associated (UBA)/TS-...		Lus10017103 [exp]	4.9	0.9199
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10002565 [exp]	5.5	0.9256
AT1G26270			Phosphatidylinositol 3- and 4-...		Lus10000012 [exp]	6.5	0.8959
AT5G37850		SOS4, ATSOS4	SALT OVERLY SENSITIVE 4, pfkB-...		Lus10000451 [exp]	6.7	0.9076
AT1G12910		LWD1, ATAN11	LIGHT-REGULATED WD 1, ANTHOCYA...		Lus10012593 [exp]	7.5	0.9090
AT4G10100		CNX7, SIR5	"co-factor for nitrate, reduct...		Lus10041075 [exp]	8.8	0.9035
AT1G34780		ATAPRL4	APR-like 4 (.1.2)		Lus10036486 [exp]	9.2	0.9239
AT4G16100			Protein of unknown function (D...		Lus10037717 [exp]	10.0	0.8975

Compare expression of checked genes

Lus10025670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.