Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G44414 133 / 5e-42 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018166 [exp] 175 / 3e-58 AT1G44414 157 / 1e-51 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G083100 [exp] 142 / 4e-45 AT1G44414 128 / 8e-40 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025672 pacid=23145111 polypeptide=Lus10025672 locus=Lus10025672.g ID=Lus10025672.BGIv1.0 annot-version=v1.0 ATGTTCTTCTTCTTCGCCGGAGGGGTGAGCCAGCAGGTCCGGCAGGTGCTGAAGCAAAACGCCGGAAAGTGCGTCAGCTGCGGCTCCCCAGCCGATCTCG TCGATTACGACAAAGTCCTCAAGCTCTTCTTCGTCCCCGTCTGGCGGTGGCCTGGTAAGGAATCCCTAATGCACTGCAACGATTGCAATATCTTCTTCCC CAAATCCTTCTCTCCTCCAACGCCGTCACAGCCGATGATCGGCGAGCGTCTGAGGTGTCGGTTCTGCGATCGGGCTGTGCAGGGCGAGTTCAGGTTCTGC CCTTTCTGCGGCTCTGATCTGTGA
AA sequence Show only first row Show all	>Lus10025672 pacid=23145111 polypeptide=Lus10025672 locus=Lus10025672.g ID=Lus10025672.BGIv1.0 annot-version=v1.0 MFFFFAGGVSQQVRQVLKQNAGKCVSCGSPADLVDYDKVLKLFFVPVWRWPGKESLMHCNDCNIFFPKSFSPPTPSQPMIGERLRCRFCDRAVQGEFRFC PFCGSDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G44414			unknown protein		Lus10025672 [exp]	0	1
AT4G11660	HSF	AT-HSFB2B, HSFB...	HEAT SHOCK TRANSCRIPTION FACTO...		Lus10008007 [exp]	2.6	0.9161
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10003399 [exp]	3.2	0.9325
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Lus10004977 [exp]	3.5	0.9230
AT1G74320			Protein kinase superfamily pro...		Lus10026145 [exp]	6.2	0.9207
AT1G17870		ATEGY3	ethylene-dependent gravitropis...		Lus10006140 [exp]	6.9	0.9168
AT1G45688			unknown protein		Lus10025793 [exp]	7.1	0.9041
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10007905 [exp]	7.2	0.9185
AT3G06780			glycine-rich protein (.1)		Lus10037706 [exp]	7.7	0.8981
AT4G15248	CO		B-box type zinc finger family ...		Lus10039694 [exp]	9.7	0.9181
AT5G28040	GeBP		DNA-binding storekeeper protei...		Lus10015944 [exp]	9.9	0.8913

Compare expression of checked genes

Lus10025672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.