Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53840 45 / 1e-06 F-box/RNI-like/FBD-like domains-containing protein (.1) AT4G03220 43 / 5e-06 Protein with RNI-like/FBD-like domains (.1) AT5G02920 43 / 5e-06 F-box/RNI-like superfamily protein (.1) AT1G16930 42 / 1e-05 F-box/RNI-like/FBD-like domains-containing protein (.1) AT5G02930 42 / 1e-05 F-box/RNI-like superfamily protein (.1) AT5G03100 41 / 2e-05 F-box/RNI-like superfamily protein (.1) AT1G67390 41 / 3e-05 F-box family protein (.1) AT1G78760 40 / 3e-05 F-box/RNI-like superfamily protein (.1) AT1G78750 40 / 4e-05 F-box/RNI-like superfamily protein (.1) AT3G59150 40 / 5e-05 F-box/RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037289 [exp] 61 / 2e-12 AT5G02920 61 / 4e-10 F-box/RNI-like superfamily protein (.1) Lus10042272 [exp] 60 / 5e-12 AT4G03220 65 / 4e-11 Protein with RNI-like/FBD-like domains (.1) Lus10003696 [exp] 59 / 1e-11 AT3G51530 52 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10028664 [exp] 56 / 1e-10 AT5G50260 59 / 6e-09 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10030031 [exp] 52 / 3e-10 AT2G04230 53 / 4e-09 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Lus10039271 [exp] 54 / 5e-10 AT5G56820 88 / 5e-19 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10029083 [exp] 54 / 6e-10 AT1G67390 54 / 6e-08 F-box family protein (.1) Lus10035326 [exp] 54 / 6e-10 AT5G27750 66 / 1e-12 F-box/FBD-like domains containing protein (.1) Lus10027471 [exp] 54 / 9e-10 AT5G22730 55 / 2e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G104200 [exp] 49 / 3e-08 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G104100 [exp] 48 / 6e-08 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.015G011200 [exp] 48 / 7e-08 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.011G104300 [exp] 47 / 1e-07 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.015G002100 [exp] 43 / 4e-06 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1) Potri.001G337200 [exp] 43 / 4e-06 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2) Potri.015G002001 [exp] 43 / 5e-06 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.013G146800 [exp] 42 / 2e-05 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1) Potri.013G151200 [exp] 40 / 6e-05 AT4G03220 417 / 1e-141 Protein with RNI-like/FBD-like domains (.1) Potri.012G099400 [exp] 40 / 7e-05 AT5G44950 77 / 1e-14 F-box/RNI-like/FBD-like domains-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025675 pacid=23145048 polypeptide=Lus10025675 locus=Lus10025675.g ID=Lus10025675.BGIv1.0 annot-version=v1.0 ATGGAGGGACGAGGAGTCATCCACACCCCCGCCGCCGGCCAGCAAGAGGACCGAATCTCAAACTTACCCGACGAAGTCATCCATGAAATCCATAAGCAAC CTGCTCAACTTGCGATCCTCTCCAAACGATGGACCCACCTCTGGCGCTCATACCCCGTCTTCGAGTTTAACCTACTCGAATGGACAATCGGGAGGAGATG GAATTGGAATCCTTTCTTACAGCTTCCGGTAAAAGGTTCTCCAACTTACAATGCGCGGTAG
AA sequence Show only first row Show all	>Lus10025675 pacid=23145048 polypeptide=Lus10025675 locus=Lus10025675.g ID=Lus10025675.BGIv1.0 annot-version=v1.0 MEGRGVIHTPAAGQQEDRISNLPDEVIHEIHKQPAQLAILSKRWTHLWRSYPVFEFNLLEWTIGRRWNWNPFLQLPVKGSPTYNAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53840			F-box/RNI-like/FBD-like domain...		Lus10025675 [exp]	0	1
AT1G60400			F-box/RNI-like superfamily pro...		Lus10038935 [exp]	1.0	1.0000
AT4G34880			Amidase family protein (.1)		Lus10002805 [exp]	2.0	0.9701
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10022204 [exp]	6.9	0.7186
AT5G62420			NAD(P)-linked oxidoreductase s...		Lus10027216 [exp]	7.3	0.7132
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	9.0	0.7217
					Lus10042413 [exp]	10.0	0.6949
AT5G67440		MEL2, NPY3	NAKED PINS IN YUC MUTANTS 3, M...		Lus10025193 [exp]	10.4	0.7217
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Lus10008888 [exp]	11.6	0.7217
					Lus10009177 [exp]	12.7	0.7217
					Lus10035026 [exp]	13.7	0.7217

Compare expression of checked genes

Lus10025675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.