Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01720 405 / 1e-143 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 319 / 6e-110 NAC ANAC032 NAC domain containing protein 32 (.1) AT5G63790 303 / 8e-103 NAC ANAC102 NAC domain containing protein 102 (.1) AT5G08790 297 / 7e-101 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 240 / 2e-78 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G15500 235 / 3e-76 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 234 / 7e-76 NAC ANAC019 NAC domain containing protein 19 (.1) AT1G61110 234 / 2e-75 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G04070 232 / 1e-74 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G15510 224 / 2e-71 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018142 [exp] 622 / 0 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10042731 [exp] 443 / 4e-158 AT1G01720 414 / 7e-147 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 325 / 1e-111 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020883 [exp] 322 / 2e-110 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10029692 [exp] 306 / 1e-104 AT1G01720 268 / 9e-90 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10032657 [exp] 243 / 2e-78 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10018469 [exp] 242 / 4e-78 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10043095 [exp] 242 / 6e-78 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10011215 [exp] 240 / 1e-77 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G081000 [exp] 433 / 2e-154 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G180200 [exp] 418 / 9e-149 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G099400 [exp] 384 / 6e-135 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G069500 [exp] 382 / 7e-134 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123300 [exp] 246 / 7e-80 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G123500 [exp] 241 / 5e-78 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.001G404400 [exp] 239 / 3e-77 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.004G038000 [exp] 239 / 5e-77 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.001G404100 [exp] 238 / 1e-76 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G046700 [exp] 237 / 3e-76 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10025690 pacid=23144989 polypeptide=Lus10025690 locus=Lus10025690.g ID=Lus10025690.BGIv1.0 annot-version=v1.0 ATGTCGCCGGCGTTGGATTTACCACCGGGATTCAGATTCCATCCGACAGACGACGAGCTGGTGATGCACTACCTAGTCAGGAAGTGCGCATCGCAGCCGA TTTCTGTTCCGATTATCGCCGAGATTGATCTCTACAAGTACGATCCATGGGATCTCCCAGGTTTGGCTCTGTATGGTGAGAAAGAGTGGTACTTCTTCTC GCCTAGAGATCGGAAGTATCCAAACGGAACCCGACCGAATCGAGCGGCGGGAACCGGTTATTGGAAGGCTACAGGAGCCGATAAGCCGATCGGTTTACCC AGACCGGTCGGAATCAAGAAAGCTCTTGTTTTCTACGCCGGGAAAGCTCCGAAGGGGGAGAAAACGAATTGGATCATGCACGAGTATAGGCTTGCCGACG TTGACCGTTCCGCCAGGAAGAAGAACAGCTTGAGGCTTGACGATTGGGTTCTGTGTCGAATCTACAACAAGAAAGGCTCGATCGAGAAGAAATCCGCGCC GGTCGCGGTGAGTCGGAGAGCGCATTCGACGGATTCGATCGAGGAGAAGAAACCGTCGCTGTTGATGTCGACGGCGCCGGTCCCTCAGCTGCCGGCGACG GTGTCCGGTGGTTATCAGCCGACGATCAACAGCTACAACAACGATTACGTGTGTTTCGAGTCGTCGGACTCGGTTCCTCGGATGAACACGGACTCGAGCT GCTCGGAGCACGTGGTGTCCCCGGAGTTCACGACCAGCGAGGTGCAGAGCGAGGCGAACTGGGGAATGAACAACGCCGGCGGTGGCTTTGACTTGGGGTT TAATTACATGGACGCCGCCATGGAAAGGGAGTTTGCGTCGCAGTTTCAGGGAGGGGCGATTAATCAGATGTCGCCGTTGCAGGATATGTTCATGTACCTG CAGAAGCCATTTTAG
AA sequence Show only first row Show all	>Lus10025690 pacid=23144989 polypeptide=Lus10025690 locus=Lus10025690.g ID=Lus10025690.BGIv1.0 annot-version=v1.0 MSPALDLPPGFRFHPTDDELVMHYLVRKCASQPISVPIIAEIDLYKYDPWDLPGLALYGEKEWYFFSPRDRKYPNGTRPNRAAGTGYWKATGADKPIGLP RPVGIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGSIEKKSAPVAVSRRAHSTDSIEEKKPSLLMSTAPVPQLPAT VSGGYQPTINSYNNDYVCFESSDSVPRMNTDSSCSEHVVSPEFTTSEVQSEANWGMNNAGGGFDLGFNYMDAAMEREFASQFQGGAINQMSPLQDMFMYL QKPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10025690 [exp]	0	1
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10018142 [exp]	1.0	0.9566
AT4G14440		HCD1, ATECI3	DELTA\(3\), DELTA\(2\)-ENOYL C...		Lus10041154 [exp]	8.5	0.9096
AT2G10950			BSD domain-containing protein ...		Lus10039982 [exp]	8.9	0.9311
AT2G32190			unknown protein		Lus10039015 [exp]	9.6	0.9258
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10004517 [exp]	10.5	0.9259
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Lus10016884 [exp]	13.6	0.9195
AT4G21510			F-box family protein (.1)		Lus10011255 [exp]	15.5	0.8874
AT5G38200			Class I glutamine amidotransfe...		Lus10028493 [exp]	16.3	0.9245
AT1G67000			Protein kinase superfamily pro...		Lus10014923 [exp]	19.0	0.9012
AT5G46550			DNA-binding bromodomain-contai...		Lus10002784 [exp]	19.2	0.9157

Compare expression of checked genes

Lus10025690 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.