Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 183 / 7e-60 ATPRB1 basic pathogenesis-related protein 1 (.1) AT1G50050 184 / 3e-59 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 174 / 3e-56 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 172 / 2e-55 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT3G19690 165 / 1e-52 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 154 / 3e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 152 / 2e-47 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 150 / 2e-46 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT4G25790 149 / 7e-46 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007102 [exp] 172 / 3e-55 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10012478 [exp] 169 / 5e-54 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 168 / 1e-53 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 164 / 5e-52 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 157 / 2e-49 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 157 / 6e-49 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 155 / 9e-49 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 146 / 1e-45 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10013693 [exp] 146 / 8e-45 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083600 [exp] 238 / 2e-81 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083300 [exp] 200 / 2e-66 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 199 / 3e-66 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 195 / 1e-64 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 191 / 9e-63 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.009G082800 [exp] 187 / 3e-61 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.009G082900 [exp] 183 / 3e-59 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 170 / 1e-54 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 169 / 3e-54 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 143 / 6e-44 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10025697 pacid=23177639 polypeptide=Lus10025697 locus=Lus10025697.g ID=Lus10025697.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAGACATCCCAACACGCTCATCTCCTTCGTCTCCTTCGGGCATCATCGTGCATACTAGTAATATCCTTCCTAGTCTGCTGCGAACCGTGCA ATGCACAGAACTCCCAACAGGACTATCTGAACGTCCACAACGTGGCTAGAGGTCAAGTCGGGGTGGCCAACATCACGTGGGACACTACACTCGCGACTTA CGCCCAAAACTATGCGAACGCGAGGGTAGCTGATTGCAACCTAGTCCACTCCGGAGGTCCTTACGGAGAGAACCTGGCCAAGGGAAGCAGCTCCACGTTC ACTGGCGTGAGTGCGGTGAACTTGTGGGTTGCTGAGAAGCCTTACTACGACTACGCATCCAACGCATGTACCGGTGGCCAGCAGTGCCTTCACTACACGC AGGTGGTGTGGGGGAACTCGGTGAGGCTCGGTTGCGCCAGGGTGCAGTGCTCTAACGGCTGGTGGTTCGTCACTTGCAATTACGATCCTCAGGGAAACTA CGCCGGCCAGCGTCCATACTAA
AA sequence Show only first row Show all	>Lus10025697 pacid=23177639 polypeptide=Lus10025697 locus=Lus10025697.g ID=Lus10025697.BGIv1.0 annot-version=v1.0 MASKTSQHAHLLRLLRASSCILVISFLVCCEPCNAQNSQQDYLNVHNVARGQVGVANITWDTTLATYAQNYANARVADCNLVHSGGPYGENLAKGSSSTF TGVSAVNLWVAEKPYYDYASNACTGGQQCLHYTQVVWGNSVRLGCARVQCSNGWWFVTCNYDPQGNYAGQRPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G50060			CAP (Cysteine-rich secretory p...		Lus10025697 [exp]	0	1
AT5G24070			Peroxidase superfamily protein...		Lus10004804 [exp]	1.4	0.9385
AT3G45070			P-loop containing nucleoside t...		Lus10033716 [exp]	4.9	0.8947
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10026040 [exp]	8.3	0.9224
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	8.4	0.9263
AT3G45070			P-loop containing nucleoside t...		Lus10031624 [exp]	12.0	0.8840
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10002894 [exp]	15.3	0.8947
AT4G33590			unknown protein		Lus10041131 [exp]	19.8	0.9213
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Lus10000857 [exp]	19.9	0.8978
AT3G24750			unknown protein		Lus10025939 [exp]	21.8	0.9162
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10022443 [exp]	24.3	0.8879

Compare expression of checked genes

Lus10025697 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.