Lus10025704 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14650 334 / 2e-109 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
AT1G14640 273 / 1e-86 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G06520 125 / 2e-32 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT4G16200 112 / 2e-29 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT3G49130 71 / 6e-14 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
AT1G18050 62 / 7e-11 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
AT2G43960 60 / 4e-10 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G12280 59 / 1e-09 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.2)
AT3G27600 58 / 2e-09 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
AT5G55100 56 / 1e-08 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035958 542 / 0 AT1G14650 886 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10013966 382 / 3e-129 AT1G14650 672 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10007278 304 / 2e-100 AT1G14650 512 / 3e-174 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10015391 180 / 2e-57 AT1G14650 119 / 4e-32 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10032646 61 / 3e-10 AT5G55100 499 / 3e-164 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Lus10043105 60 / 6e-10 AT5G55100 504 / 1e-165 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Lus10015703 47 / 1e-05 AT3G52120 477 / 2e-166 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G070700 438 / 1e-149 AT1G14650 810 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.005G094600 430 / 2e-146 AT1G14650 814 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.001G356800 58 / 4e-09 AT5G55100 420 / 6e-133 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Potri.001G269900 47 / 7e-06 AT3G52120 500 / 3e-176 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
Potri.009G064600 47 / 8e-06 AT3G52120 509 / 1e-179 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein
PF01805 Surp Surp module
Representative CDS sequence
>Lus10025704 pacid=23177439 polypeptide=Lus10025704 locus=Lus10025704.g ID=Lus10025704.BGIv1.0 annot-version=v1.0
ATGCCAGGCACAGCAATTTTGACTCTGCCAGCACCTCCTCCTCACTCAGAAGGGTCTCCTCCTCCCCCATCCCAACTGTCAGAACATAATTCCAATGAAG
AAAACCCAGTGAATGAGGAACATAATAGAGCTCCGGTTGCTACCCACACCAGAACCATTGGAATTATTCATCCTCCTCCAGATATCAGGAATATTGTTGA
CAAAACAGCCCAGTTTGTTGCCAAAAATGGACCCGAGTTTGAGAAAAGGATTATGGCTCATAATGCCAACAATGCTAAATTCAACTTTTTGAATCCCAAC
GATCCATATCATGCATATTATCAACATCGGTTGTCCGAGTCTCGCACCCAGAATCTGTCTTCTACACAACAGCCTACCTCTGATCTGCCAGATTCTGCTG
CCCCTGAGTCTATTCCATCTGGTGCTGATGATGATGGAACCGAAGCAGCTCCAAAGCCTGACCCTGCTGCCCAATTTAGACTACCAACTCGCAAGGTTCT
TGAACCACCTGAAGCTGAGCAGTATACAGTTCGGCTTCCTGAAGGGATTACTGGAGAAGAACTTGATATTATTAAGCTGACTGCACAGTTTGTAGCACGC
AATGGGCAAACATTCCTTACTGGCCTCACTAATAGGGAGATGAACAACTCCCAGTTCCACTTTATGAAGCCAACCCACAGCATGTTTACTTTCTTCACAG
GCCTTGCAGATGCCTATTCAAAAGTGCTGATGCCTCCAAAAGGTTTAACAGAGAAGTTGACAAACAGTGTTGCTGACATGACCACTGTGCTTGAGAGATG
TTTGCATCGTCTAGAGTGGGAGCGGTCACAGGAGCAGGCAAGACAGAAGGCCGAGGATGAGACGAGCTGA
AA sequence
>Lus10025704 pacid=23177439 polypeptide=Lus10025704 locus=Lus10025704.g ID=Lus10025704.BGIv1.0 annot-version=v1.0
MPGTAILTLPAPPPHSEGSPPPPSQLSEHNSNEENPVNEEHNRAPVATHTRTIGIIHPPPDIRNIVDKTAQFVAKNGPEFEKRIMAHNANNAKFNFLNPN
DPYHAYYQHRLSESRTQNLSSTQQPTSDLPDSAAPESIPSGADDDGTEAAPKPDPAAQFRLPTRKVLEPPEAEQYTVRLPEGITGEELDIIKLTAQFVAR
NGQTFLTGLTNREMNNSQFHFMKPTHSMFTFFTGLADAYSKVLMPPKGLTEKLTNSVADMTTVLERCLHRLEWERSQEQARQKAEDETS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14650 SWAP (Suppressor-of-White-APri... Lus10025704 0 1
AT2G38770 EMB2765 EMBRYO DEFECTIVE 2765, P-loop ... Lus10019778 3.2 0.9462
AT4G21710 NRPB2, EMB1989 EMBRYO DEFECTIVE 1989, DNA-dir... Lus10011182 3.5 0.9332
AT2G28070 ABCG3 ATP-binding cassette G3, ABC-2... Lus10041333 4.0 0.9062
AT3G23780 NRPE2, DMS2, DR... DEFECTIVE IN MERISTEM SILENCIN... Lus10027166 4.2 0.9265
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10001371 4.6 0.9154
AT2G04660 APC2 anaphase-promoting complex/cyc... Lus10030444 4.9 0.9164
AT5G36950 DEGP10 DegP protease 10 (.1) Lus10008726 7.3 0.9141
AT1G08060 MOM1, MOM MORPHEUS MOLECULE 1, MORPHEUS ... Lus10021457 7.7 0.9009
AT5G11560 catalytics (.1) Lus10022144 8.0 0.9152
AT1G14850 NUP155 nucleoporin 155 (.1) Lus10003701 8.2 0.9197

Lus10025704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.