Lus10025705 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14650 191 / 3e-54 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
AT1G14640 183 / 1e-51 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G12280 115 / 2e-28 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.2)
AT5G06890 67 / 3e-14 Ubiquitin-like superfamily protein (.1)
AT5G42220 44 / 0.0001 Ubiquitin-like superfamily protein (.1)
AT2G35635 40 / 0.0007 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1)
AT1G31340 40 / 0.0008 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
AT3G27600 0 / 1 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035958 447 / 1e-151 AT1G14650 886 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10013966 214 / 2e-63 AT1G14650 672 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10007278 191 / 2e-55 AT1G14650 512 / 3e-174 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10034563 42 / 0.0006 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G070700 215 / 4e-63 AT1G14650 810 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.005G094600 211 / 1e-61 AT1G14650 814 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.005G096700 40 / 0.0008 AT1G31340 270 / 2e-94 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
Potri.002G062500 40 / 0.0008 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
Potri.005G198700 40 / 0.0009 AT1G31340 293 / 1e-103 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
Potri.016G077000 39 / 0.0009 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein
Representative CDS sequence
>Lus10025705 pacid=23177592 polypeptide=Lus10025705 locus=Lus10025705.g ID=Lus10025705.BGIv1.0 annot-version=v1.0
ATGTCAGAACACATGAGGATTTCTCTAATTGATCCCAAGTACAAGGAGCAAAAGGAGAGGATGTTTGCTAAGATTCGGGAGACCACTCTTGCTGCCGATG
ATGAAATTTCAAAAAACATTGTGGGCCTTGCACGAACCCGTCCTGATATTTTTGGCACAACAGAGGAGGAGGTGTCTAACGCAGTTCAGGCTGAAATTGA
GAAAAAGAAAGATGAGCAACCAAAGCAGGTTATATGGGATGGCCACACTGGAAGCATTGGGCGCACTGCTAACCAGGCAATGTCCCAAAGTCTTGGTGAC
GATCAAAATGAGGCTATGAACAGTGACGGACGAAACTTACCTGGACCAGCTGCTCCTCCTCCCCGTCCTGGTCTACCATCACTTCGACCGCTTCCTCCAC
CGCCTGGACTGGCTCTTAATGTCCCCCGCATGCCTCCAAATGCAGTCTCATATTCAACTTCTATGGGTGGTGGATATCCTGTCCCTCTGCCAAGGCCACC
AGGTATGCCATTGATGCCAACAATTCGTCCACCACCTCCTCCAATGCCAGGACAGCAGCCGATGATGATGAATCAACCTTCCTCTATGAATCCACCAAAC
ATGCCAGTACCACCTCCACCAGGCTCTCAGTTTGCTCCCATGCCAATGCACCGTCCTTTTGCCCCTATGTCTATGCCTCCACCACACATGCATGCAATGG
CCCCGCCTCCACCCTTACCTCAGGGGGTGCCTCCACCACCTCCTTCTGAGGATGCTCCTCCACTTCCAGAAGAACCCGAGCCCAAGAGGCAGAAGCTAGA
TGATTCAATGCTTATTCCAGAAGAGCAGTTTTTGGCCCAGCATCCGGGACCTGCAAGCATCAGTGTTACTGTTCCTAGTGTCGATGAAGGAAATCTAAGA
GGTCAAGTGCTGGAGATTAGAGTCCAATCATTGTCAGAAACGATTCTCAGTCTGAAGGAGAAGATTGCAGGAGAGATCCAACTTGCTTCCAACAAGCAGA
AATTGAGTCAAAAGGCTCGTTTCCTGAAGGATAATATGAGCCTTGCTTACTACAATGTCCGCGGTGGAGATTCACTTACTCTGACGTTGAGAGAGCGCGG
TGGGAAAAAGAAATAA
AA sequence
>Lus10025705 pacid=23177592 polypeptide=Lus10025705 locus=Lus10025705.g ID=Lus10025705.BGIv1.0 annot-version=v1.0
MSEHMRISLIDPKYKEQKERMFAKIRETTLAADDEISKNIVGLARTRPDIFGTTEEEVSNAVQAEIEKKKDEQPKQVIWDGHTGSIGRTANQAMSQSLGD
DQNEAMNSDGRNLPGPAAPPPRPGLPSLRPLPPPPGLALNVPRMPPNAVSYSTSMGGGYPVPLPRPPGMPLMPTIRPPPPPMPGQQPMMMNQPSSMNPPN
MPVPPPPGSQFAPMPMHRPFAPMSMPPPHMHAMAPPPPLPQGVPPPPPSEDAPPLPEEPEPKRQKLDDSMLIPEEQFLAQHPGPASISVTVPSVDEGNLR
GQVLEIRVQSLSETILSLKEKIAGEIQLASNKQKLSQKARFLKDNMSLAYYNVRGGDSLTLTLRERGGKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14650 SWAP (Suppressor-of-White-APri... Lus10025705 0 1
AT1G71800 CSTF64 cleavage stimulating factor 64... Lus10009670 1.4 0.9404
AT1G73840 ESP1 ENHANCED SILENCING PHENOTYPE 1... Lus10009030 2.8 0.9300
AT1G17370 UBP1B oligouridylate binding protein... Lus10013167 5.1 0.9031
AT3G43590 zinc knuckle (CCHC-type) famil... Lus10013378 5.3 0.9029
AT3G22990 LFR LEAF AND FLOWER RELATED, ARM r... Lus10006635 6.2 0.8969
AT3G21350 MED6 RNA polymerase transcriptional... Lus10022814 7.5 0.9165
AT1G30460 C3HZnF CPSF30, ATCPSF3... ARABIDOPSIS THALIANA CLEAVAGE ... Lus10023254 8.5 0.9098
AT4G03120 C2H2 and C2HC zinc fingers sup... Lus10037576 9.3 0.8545
AT1G07360 C3HZnF MAC5A MOS4-associated complex subuni... Lus10035658 10.2 0.9063
AT2G01710 Chaperone DnaJ-domain superfam... Lus10015891 11.0 0.8637

Lus10025705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.