Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39725 127 / 4e-40 LYR family of Fe/S cluster biogenesis protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035952 [exp] 172 / 1e-57 AT2G39725 129 / 9e-41 LYR family of Fe/S cluster biogenesis protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G018100 [exp] 132 / 7e-42 AT2G39725 121 / 2e-37 LYR family of Fe/S cluster biogenesis protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [flax] [poplar] LYR-like PF05347 [flax] [poplar] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Lus10025710 pacid=23177616 polypeptide=Lus10025710 locus=Lus10025710.g ID=Lus10025710.BGIv1.0 annot-version=v1.0 ATGGGCGCACCCAGACTGTCCGGGATGCAGAAGCAAGTTCTGAGCCTCTACCGAGGGTTTCTCCGAGCTGCCCGTTTGAAATCTGCGGACGAACGGAAGC AGATCGAAACCATTGTATCGGCAGAGTTCCGCCGAAACTCGAAGCAAGTGGATCGGAAGAATTTCGTGTACATTGAGTACTTGCTCAACCGTGGGAAGAA GCAGCTAGATCAGCTCAAGAGCCCAGGCGTCGTTGGATTATCATCTTTCAATGTCGGCCGATCCTGA
AA sequence Show only first row Show all	>Lus10025710 pacid=23177616 polypeptide=Lus10025710 locus=Lus10025710.g ID=Lus10025710.BGIv1.0 annot-version=v1.0 MGAPRLSGMQKQVLSLYRGFLRAARLKSADERKQIETIVSAEFRRNSKQVDRKNFVYIEYLLNRGKKQLDQLKSPGVVGLSSFNVGRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39725			LYR family of Fe/S cluster bio...		Lus10025710 [exp]	0	1
AT1G22520			Domain of unknown function (DU...		Lus10001541 [exp]	8.1	0.6373
AT3G25220		FKBP15-1	FK506-binding protein 15 kD-1 ...		Lus10002339 [exp]	9.4	0.7140
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10031932 [exp]	15.0	0.6515
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10041296 [exp]	16.1	0.6636
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10014951 [exp]	17.9	0.6890
AT1G77350			unknown protein		Lus10018864 [exp]	22.7	0.6608
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Lus10027669 [exp]	28.9	0.6443
AT3G10950			Zinc-binding ribosomal protein...		Lus10011359 [exp]	32.1	0.6488
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	34.7	0.6487
AT5G54750			Transport protein particle (TR...		Lus10028720 [exp]	34.9	0.6514

Compare expression of checked genes

Lus10025710 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.