Lus10025737 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22420 270 / 2e-91 Peroxidase superfamily protein (.1)
AT5G19890 138 / 5e-40 Peroxidase superfamily protein (.1)
AT2G18140 134 / 3e-38 Peroxidase superfamily protein (.1)
AT2G18150 134 / 4e-38 Peroxidase superfamily protein (.1)
AT4G36430 132 / 7e-38 Peroxidase superfamily protein (.1)
AT2G38390 131 / 3e-37 Peroxidase superfamily protein (.1)
AT5G66390 130 / 9e-37 Peroxidase superfamily protein (.1)
AT2G38380 128 / 8e-36 Peroxidase superfamily protein (.1)
AT5G06730 127 / 2e-35 Peroxidase superfamily protein (.1)
AT5G06720 126 / 2e-35 ATPA2 peroxidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035925 356 / 1e-125 AT2G22420 418 / 1e-147 Peroxidase superfamily protein (.1)
Lus10026748 128 / 6e-36 AT5G19890 402 / 6e-141 Peroxidase superfamily protein (.1)
Lus10008168 126 / 4e-35 AT5G06720 393 / 5e-137 peroxidase 2 (.1)
Lus10041784 124 / 2e-34 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1)
Lus10010634 123 / 7e-34 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Lus10027989 123 / 9e-34 AT5G06720 400 / 1e-139 peroxidase 2 (.1)
Lus10025535 124 / 1e-33 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10008174 120 / 8e-33 AT5G06730 382 / 2e-132 Peroxidase superfamily protein (.1)
Lus10008167 120 / 1e-32 AT5G06720 399 / 3e-139 peroxidase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G096200 263 / 1e-88 AT2G22420 521 / 0.0 Peroxidase superfamily protein (.1)
Potri.005G072800 257 / 2e-86 AT2G22420 521 / 0.0 Peroxidase superfamily protein (.1)
Potri.001G011200 137 / 1e-39 AT3G49120 381 / 2e-132 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Potri.001G012901 136 / 3e-39 AT5G06730 387 / 1e-134 Peroxidase superfamily protein (.1)
Potri.001G011000 132 / 2e-37 AT3G49120 407 / 1e-142 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Potri.003G214800 129 / 3e-36 AT5G06720 451 / 5e-160 peroxidase 2 (.1)
Potri.003G214700 129 / 4e-36 AT5G06720 459 / 5e-163 peroxidase 2 (.1)
Potri.003G214900 127 / 9e-36 AT4G08780 400 / 6e-140 Peroxidase superfamily protein (.1)
Potri.001G011300 127 / 1e-35 AT3G49120 410 / 8e-144 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Potri.002G031200 125 / 9e-35 AT1G44970 492 / 6e-176 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10025737 pacid=23177517 polypeptide=Lus10025737 locus=Lus10025737.g ID=Lus10025737.BGIv1.0 annot-version=v1.0
ATGGCCTCCCGTGACGCTGTTTCCCTCACGGGTGGGCCCCAGTGGGAAGTGAAGCTGGGGAGGCTGGACAGTCTGACGGCGAGCCAGGCCGACGCCGACG
CAATCATGCCAAGCCCGAGAGCCAACGCCACGATGCTGATCGACCTCTTCGAGAGATTCAACCTCTCGCTCTACAACCAGTCCGGGTCGGGCCGACCCGA
CCCTGCGATTGAGCCAGGGTACAGGCAGAAGCTGATGGAGCTTTGTCCGATGGGGGGAGACGAGAACGTGACGGTGGGTTTGGATTCGACTCCGCTTGTG
TTCGACAACGTGTATTTCAAGGATTTGGTGGGCGGGAGAGGGTTCTTGAACTCCGACGAAACGCTCTTCACTTATCCAATCACCAGGAAGTACGTGCAGG
AGTTCGGCCGGGATCAGGATGCGTTTTTTGAGGCGTTTGCGGAAGGGATGATTAAGATGGGTGACTTGCAGTCTGGGCTGCCAGGTGAAGTCAGGAGGAA
CTGCCGGGTTGCTAATGGCGGCCGGCGGCAGGTCAGCAATCGATTGAGCAGCTTCAGTTAA
AA sequence
>Lus10025737 pacid=23177517 polypeptide=Lus10025737 locus=Lus10025737.g ID=Lus10025737.BGIv1.0 annot-version=v1.0
MASRDAVSLTGGPQWEVKLGRLDSLTASQADADAIMPSPRANATMLIDLFERFNLSLYNQSGSGRPDPAIEPGYRQKLMELCPMGGDENVTVGLDSTPLV
FDNVYFKDLVGGRGFLNSDETLFTYPITRKYVQEFGRDQDAFFEAFAEGMIKMGDLQSGLPGEVRRNCRVANGGRRQVSNRLSSFS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22420 Peroxidase superfamily protein... Lus10025737 0 1
AT2G46220 Uncharacterized conserved prot... Lus10012651 1.7 0.8486
AT4G38810 Calcium-binding EF-hand family... Lus10012178 2.0 0.8456
AT5G02800 CDL1 CDG1-like 1, Protein kinase su... Lus10014019 2.4 0.8301
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10023530 6.3 0.8277
AT4G38810 Calcium-binding EF-hand family... Lus10007567 6.3 0.8253
AT5G10860 CBSX3 CBS domain containing protein ... Lus10034441 6.3 0.7849
AT1G80940 unknown protein Lus10041624 9.8 0.8154
AT1G80940 unknown protein Lus10024095 11.0 0.7776
AT3G16500 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible... Lus10006842 11.6 0.7847
AT2G46220 Uncharacterized conserved prot... Lus10010135 12.4 0.8054

Lus10025737 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.