Lus10025748 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47550 36 / 0.001 Cystatin/monellin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027320 47 / 9e-08 AT5G47550 59 / 4e-12 Cystatin/monellin superfamily protein (.1)
Lus10039104 45 / 4e-07 AT5G47550 74 / 4e-18 Cystatin/monellin superfamily protein (.1)
Lus10002838 41 / 5e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G014700 46 / 2e-07 AT5G47550 62 / 3e-13 Cystatin/monellin superfamily protein (.1)
Potri.006G014500 42 / 5e-06 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10025748 pacid=23177644 polypeptide=Lus10025748 locus=Lus10025748.g ID=Lus10025748.BGIv1.0 annot-version=v1.0
ATGGCGGTGGCTCTTCTGGCGACTTTAGCCTCATCATTTGTGACCACAATAATGGCGTTCGGGGTCCTCTTTGATCCTAGTTGGGTGCCTATCAAGGATT
TGACGGACAAGAAGATTGTAGCGATCGCTGAATTCGGGGTCAAAACTTACAACAAAGCGTATCCAAACCATGAACCGTTGAAGCTTGCGAGCGTGGACAA
GGGAGAAGTACTGGCTGAGCAAGCAGCAGCAGCAGCAGCAGCAGCAATACTCCCTCGTAGAACAGAGTGGGGTGTAATCCGTGGACTGAGATTATGGAAG
CCCCCTGTTGTTGATACCAAGCATTAG
AA sequence
>Lus10025748 pacid=23177644 polypeptide=Lus10025748 locus=Lus10025748.g ID=Lus10025748.BGIv1.0 annot-version=v1.0
MAVALLATLASSFVTTIMAFGVLFDPSWVPIKDLTDKKIVAIAEFGVKTYNKAYPNHEPLKLASVDKGEVLAEQAAAAAAAAILPRRTEWGVIRGLRLWK
PPVVDTKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025748 0 1
AT3G07070 Protein kinase superfamily pro... Lus10011866 4.9 0.8782
AT5G26594 ARR24 response regulator 24 (.1) Lus10004775 6.6 0.8678
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039426 7.2 0.7904
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10026765 8.1 0.8678
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10019853 9.4 0.8678
AT4G14103 F-box/RNI-like superfamily pro... Lus10020635 9.9 0.7671
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10036457 10.5 0.8678
AT5G41040 HXXXD-type acyl-transferase fa... Lus10039329 11.5 0.8678
AT3G57530 ATCPK32, CDPK32... calcium-dependent protein kina... Lus10042370 13.6 0.8546
AT4G13250 NYC1, NYC NON-YELLOW COLORING 1, NAD(P)-... Lus10034917 14.7 0.8545

Lus10025748 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.