Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52820 77 / 3e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 66 / 3e-14 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 60 / 7e-12 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G28030 56 / 1e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52790 55 / 5e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G23340 52 / 4e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G02400 50 / 1e-08 ATGA2OX4, ATGA2OX6, DTA1 DOWNSTREAM TARGET OF AGL15 1, ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 6, Arabidopsis thaliana gibberellin 2-oxidase 4, gibberellin 2-oxidase 6 (.1) AT4G21200 50 / 2e-08 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) AT1G80320 50 / 2e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G34555 50 / 3e-08 ATGA2OX3 gibberellin 2-oxidase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016659 [exp] 81 / 3e-19 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 75 / 3e-17 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016660 [exp] 66 / 2e-15 AT1G52820 95 / 2e-24 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008097 [exp] 57 / 1e-10 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10006575 [exp] 56 / 1e-10 AT1G52820 221 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 56 / 1e-10 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10013132 [exp] 55 / 5e-10 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10038498 [exp] 52 / 4e-09 AT1G78440 258 / 2e-86 Arabidopsis thaliana gibberellin 2-oxidase 1 (.1) Lus10005776 [exp] 52 / 7e-09 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176200 [exp] 86 / 3e-21 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 79 / 5e-19 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 79 / 1e-18 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 64 / 2e-13 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 61 / 2e-12 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176000 [exp] 61 / 5e-12 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 60 / 7e-12 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176100 [exp] 59 / 2e-11 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G128100 [exp] 51 / 7e-09 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G378400 [exp] 50 / 3e-08 AT1G78440 404 / 1e-141 Arabidopsis thaliana gibberellin 2-oxidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10025760 pacid=23177472 polypeptide=Lus10025760 locus=Lus10025760.g ID=Lus10025760.BGIv1.0 annot-version=v1.0 ATGATGGGATTAACAATGTTAATGAATGTGATGAAGAATCCAAGTTTGGGGCTGAATTCCCACATGGATCAAGATCTTATGACGATTCTGTACTCGAATT ACGCCGGCGAGCTGGAGATCCTCACCAAAGATGGTCATCACTGGATCAGCTCTGAAGCCACCTCCCAAGATTTCATCGTCTTCGTTGGCGAATCTCTTCA CGCGTGGACGAACGGGAGGCTGCACTGTCCGTATCACAGGGTTAGAGATGACGGGAAGGGAGGCGAGAGACTCTGCGGCGGTGTTCACGGCGTTTAA
AA sequence Show only first row Show all	>Lus10025760 pacid=23177472 polypeptide=Lus10025760 locus=Lus10025760.g ID=Lus10025760.BGIv1.0 annot-version=v1.0 MMGLTMLMNVMKNPSLGLNSHMDQDLMTILYSNYAGELEILTKDGHHWISSEATSQDFIVFVGESLHAWTNGRLHCPYHRVRDDGKGGERLCGGVHGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10025760 [exp]	0	1
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	4.0	0.7340
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	5.7	0.7340
					Lus10017855 [exp]	6.5	0.5659
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	6.9	0.7340
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	8.0	0.7340
AT2G44220			Protein of Unknown Function (D...		Lus10006862 [exp]	8.9	0.7340
AT4G26466		LRE	lorelei (.1)		Lus10011066 [exp]	10.1	0.6689
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	17.9	0.6500
					Lus10005514 [exp]	19.2	0.6500
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	20.3	0.6500

Compare expression of checked genes

Lus10025760 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.