Lus10025781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025782 217 / 3e-69 ND /
Lus10037541 101 / 3e-26 AT3G14300 41 / 4e-04 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Lus10038294 87 / 4e-20 ND 42 / 4e-04
Lus10025807 86 / 2e-19 ND 39 / 0.002
Lus10025806 74 / 3e-15 ND 40 / 0.002
Lus10011452 72 / 7e-15 ND /
Lus10038295 72 / 9e-15 ND 37 / 0.005
Lus10037542 70 / 1e-14 ND /
Lus10011453 66 / 7e-13 ND 36 / 0.008
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G119200 44 / 2e-05 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194900 42 / 0.0002 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194800 42 / 0.0002 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10025781 pacid=23177459 polypeptide=Lus10025781 locus=Lus10025781.g ID=Lus10025781.BGIv1.0 annot-version=v1.0
ATGACGACGACTAAGAAGATTTCATCAAGAGGAGTATTTCTAATGTTAACAATTTCATGTTTTTTTCCAGTTTCAACACTTGCAGACTCATCAAGTGGCT
CCTCTTCATCATCATCGTCTAAATCCGGCAGTGAAGATTCAAAGGTCGAAAATGCATCAGCAGCCGTGAAAGAGATATGTGCCTCGATGGAGAAGCCAAC
CAAGTGCCAAAAATTTTTGGCGAATAGCCCCGAAGCGGACCCAACCCACATGGTCAAGTTCAACCTTGGTGTATTGAAGAGCCTTGTAGAAGAAGGCACC
TACATTTCGTCCAAGGACGAGCTTAGGAACCCTTCCACACCTGATAAAATGAAGGAGAGCCTCGACACTTGCATCCAGAACTATGACAAGGCCGTCAGCA
GCTTGGAAGCTGCCGGAAATGCCTGCCGCGATTGCGAGAAAGAAGCCAGTTCTAGCAAGGACAAGAAGTGCAAGTCGAAGCATGTCAAAAAGGTCACGTC
CATGCTAACCAAGGTCGTTTCACATTTTAAAAAGTGCAGCGAGGCGTTGGAGAGTGCGGGTTCGCCACCCAAGCCGTGGATTAAAGAGCTCGATGATGCC
ATGATCGATGGTGCAGACATTTTGCTGAAAGTTGCTAAGAGAATCAAGTGA
AA sequence
>Lus10025781 pacid=23177459 polypeptide=Lus10025781 locus=Lus10025781.g ID=Lus10025781.BGIv1.0 annot-version=v1.0
MTTTKKISSRGVFLMLTISCFFPVSTLADSSSGSSSSSSSKSGSEDSKVENASAAVKEICASMEKPTKCQKFLANSPEADPTHMVKFNLGVLKSLVEEGT
YISSKDELRNPSTPDKMKESLDTCIQNYDKAVSSLEAAGNACRDCEKEASSSKDKKCKSKHVKKVTSMLTKVVSHFKKCSEALESAGSPPKPWIKELDDA
MIDGADILLKVAKRIK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025781 0 1
Lus10000977 3.2 1.0000
Lus10000363 3.3 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10002747 3.9 1.0000
AT3G61150 HD HD-GL2-1, HDG1 HOMEODOMAIN-GLABRA2 1, homeodo... Lus10003300 5.0 1.0000
Lus10004996 5.5 1.0000
AT2G37890 Mitochondrial substrate carrie... Lus10006265 5.9 1.0000
AT1G20480 AMP-dependent synthetase and l... Lus10011621 6.3 1.0000
Lus10003285 6.6 1.0000
AT5G12060 Plant self-incompatibility pro... Lus10022829 6.7 1.0000
Lus10027602 7.1 1.0000

Lus10025781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.