Lus10025790 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52280 258 / 3e-88 AtRABG3d RAB GTPase homolog G3D (.1)
AT3G16100 254 / 4e-87 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1)
AT3G18820 241 / 1e-81 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1)
AT1G49300 233 / 8e-79 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2)
AT1G22740 187 / 2e-60 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1)
AT4G09720 182 / 1e-58 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4)
AT2G21880 153 / 3e-47 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2)
AT5G39620 98 / 1e-25 AtRABG1 RAB GTPase homolog G1 (.1)
AT2G44610 70 / 6e-15 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1)
AT5G10260 58 / 2e-10 AtRABH1e RAB GTPase homolog H1E (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035872 291 / 3e-101 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1)
Lus10040468 237 / 4e-80 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1)
Lus10042328 172 / 1e-54 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1)
Lus10028719 169 / 2e-53 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4)
Lus10006059 156 / 1e-48 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4)
Lus10023582 150 / 4e-46 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1)
Lus10019501 65 / 6e-13 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1)
Lus10043349 65 / 6e-13 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1)
Lus10026045 61 / 6e-12 AT5G10260 209 / 5e-70 RAB GTPase homolog H1E (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G053400 249 / 8e-85 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1)
Potri.009G115000 246 / 9e-84 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1)
Potri.004G153400 246 / 1e-83 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1)
Potri.001G182900 245 / 2e-83 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1)
Potri.002G062400 189 / 2e-61 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4)
Potri.005G198800 181 / 6e-58 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4)
Potri.005G085300 160 / 5e-50 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4)
Potri.007G079700 124 / 5e-36 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4)
Potri.002G135500 69 / 2e-14 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1)
Potri.003G086700 66 / 3e-13 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10025790 pacid=23177443 polypeptide=Lus10025790 locus=Lus10025790.g ID=Lus10025790.BGIv1.0 annot-version=v1.0
ATGGCTTCTCGTCGGCGGATGCTCCTCAAGGTCATTATTCTCGGCGATAGCGGGTACTTTGTCTTCCTCCTCTCCTTCCTCTTTTTCTTCTTCTCATTTG
TCCATTATTCTCACGAATCAATTCTTCCATCTCGTTACAGGGTAGGCAAAACTTCACTGATGAATCAGTATGTAAATCGAAAGTTTAACAATCAGTACAA
GGCGACGATAGGAGCCGATTTCCTCACAAAGGAAGTTCAGTTTGAGGACAGATTGTTCACATTGCAGGCTAGTCCACCTGATCCAGAAAACTTCCCATTT
GTCGTGCTAGGAAATAAGGTAGATATAGACGGTGGCAATAGTCGAGTGGTTTCTGAAAAGAAAGCAAAGGCTTGGTGTGCTTCAAAAGGAAACATACCCT
ACTTTGAGACTTCTGCAAAAGAAGGATTCAACGTGGATGCTGCTTTCGAGTGCATAGCAAAGAATGCGCTTAAGAATGAACCAGAAGAGGAAATGTATCT
ACCTGACACCATTGATGTTGGAGTTGGAGGGCAGCAACAGAGATCCACAGGCTGTGAATGTTGA
AA sequence
>Lus10025790 pacid=23177443 polypeptide=Lus10025790 locus=Lus10025790.g ID=Lus10025790.BGIv1.0 annot-version=v1.0
MASRRRMLLKVIILGDSGYFVFLLSFLFFFFSFVHYSHESILPSRYRVGKTSLMNQYVNRKFNNQYKATIGADFLTKEVQFEDRLFTLQASPPDPENFPF
VVLGNKVDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAAFECIAKNALKNEPEEEMYLPDTIDVGVGGQQQRSTGCEC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52280 AtRABG3d RAB GTPase homolog G3D (.1) Lus10025790 0 1
AT5G42560 Abscisic acid-responsive (TB2/... Lus10024332 6.9 0.6688
AT3G26770 NAD(P)-binding Rossmann-fold s... Lus10041518 7.1 0.6961
AT5G58060 ATYKT61, ATGP1,... SNARE-like superfamily protein... Lus10019047 10.5 0.7375
AT3G45020 Ribosomal L18p/L5e family prot... Lus10016132 14.4 0.7394
AT3G27950 GDSL-like Lipase/Acylhydrolase... Lus10008784 15.6 0.6873
AT1G31812 ACBP6, ACBP acyl-CoA-binding protein 6 (.1... Lus10013605 15.9 0.7319
AT5G57860 Ubiquitin-like superfamily pro... Lus10036598 20.8 0.7210
AT3G29130 unknown protein Lus10038450 27.6 0.6948
AT5G42770 Maf-like protein (.1.2) Lus10002531 31.6 0.7064
AT3G59470 FAR1_related Far-red impaired responsive (F... Lus10026854 34.6 0.7082

Lus10025790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.