Lus10025791 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15230 84 / 5e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035871 225 / 2e-76 AT1G15230 90 / 3e-23 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G053500 129 / 1e-38 AT1G15230 92 / 3e-24 unknown protein
PFAM info
Representative CDS sequence
>Lus10025791 pacid=23177456 polypeptide=Lus10025791 locus=Lus10025791.g ID=Lus10025791.BGIv1.0 annot-version=v1.0
ATGGAAGCGAGTCAGGGCAAAGAAGCAACTGGAGGGCTGCTCCACCAGATCCTACCCCCGCGGCTGGAAGACGCCGGTCTAGAAGACTGCGCGCTTCCTC
CGGACTCCATCAAAGAAGCATTTCTCAAAGCCGCCTCCGCTGTAAAATCCCGTGCAACCTCCATCTTCAACGACAGCGAAGATGATTGCGTGCAGGATCC
CTGGCCGGGGGGAGAGGCCAATGATGTCTCTGATGATATTAATGTCGGTCTTCCACCTCTGGACGGCGGCGCGGACGCGCTGGTGGGGATAAACGAGGGT
TTAGATGAGAAGGGAAGCTGCGTGAAAGGCTTGGATTCGGTCGAGAAGGACCAGGATCAAGTGGTGGTAGTCGGGGGTGAGGTGGATGATAGCGGTCCCT
GTAAGGGTTTGGAAATTGGGGGAAAAGCGAAGAATGATGAGATTGAGGATGATGAAGAGAAGGAGAGACCAATTTTGACTGGAGGCTTTATGTAA
AA sequence
>Lus10025791 pacid=23177456 polypeptide=Lus10025791 locus=Lus10025791.g ID=Lus10025791.BGIv1.0 annot-version=v1.0
MEASQGKEATGGLLHQILPPRLEDAGLEDCALPPDSIKEAFLKAASAVKSRATSIFNDSEDDCVQDPWPGGEANDVSDDINVGLPPLDGGADALVGINEG
LDEKGSCVKGLDSVEKDQDQVVVVGGEVDDSGPCKGLEIGGKAKNDEIEDDEEKERPILTGGFM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15230 unknown protein Lus10025791 0 1
AT5G09570 Cox19-like CHCH family protein... Lus10007086 7.1 0.8093
AT2G43090 Aconitase/3-isopropylmalate de... Lus10007488 13.7 0.7776
AT5G42060 DEK, chromatin associated prot... Lus10032409 15.9 0.7917
AT4G37830 cytochrome c oxidase-related (... Lus10011574 23.2 0.7704
AT3G57560 NAGK N-acetyl-l-glutamate kinase (.... Lus10030889 23.4 0.7527
AT2G20940 Protein of unknown function (D... Lus10025069 25.1 0.7748
AT5G35320 unknown protein Lus10027608 28.2 0.7504
AT5G65100 EIL Ethylene insensitive 3 family ... Lus10041709 28.5 0.6623
Lus10032951 28.5 0.7621
AT5G13860 ELC-LIKE, ATELC... ELCH-like (.1) Lus10026129 29.4 0.7441

Lus10025791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.