Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 172 / 1e-57 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 150 / 3e-49 Dynein light chain type 1 family protein (.1) AT4G27360 104 / 7e-31 Dynein light chain type 1 family protein (.1) AT5G20110 82 / 1e-20 Dynein light chain type 1 family protein (.1) AT1G23220 76 / 3e-19 Dynein light chain type 1 family protein (.1) AT4G15930 74 / 3e-18 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035868 [exp] 186 / 3e-63 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 169 / 2e-56 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 158 / 6e-52 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 112 / 8e-34 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 112 / 2e-33 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 100 / 7e-29 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 85 / 1e-22 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 81 / 9e-21 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 79 / 3e-19 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G052800 [exp] 180 / 9e-61 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 113 / 5e-34 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 104 / 1e-30 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 101 / 2e-29 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 96 / 2e-27 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 84 / 4e-22 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 83 / 5e-22 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 76 / 6e-18 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 72 / 2e-17 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 71 / 2e-17 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10025794 pacid=23177667 polypeptide=Lus10025794 locus=Lus10025794.g ID=Lus10025794.BGIv1.0 annot-version=v1.0 ATGTTGGAAGGAAAAGCGGTGGTCAATGATACAGATATGCCAGTGAAGAGGCAGATCCAAGCCATGTCTTGTGCCTCTCAAGCTTTAGATCTTTATGACG TCCTTGACTGCAAATCCATCGCAGGCCACATCAAGAAGGAGTTCGACATGAGATATGGAGGCGGATGGCAATGCGTGGTCGGTTCGAACTTTGGTTGCTT CTTCACTCACTCTAAAGGAACTTTCATTTACTTCACAGTGGAAACCCTGAAATTTCTCATCTTCAAAGGAGCTTCTTCTCCCTGA
AA sequence Show only first row Show all	>Lus10025794 pacid=23177667 polypeptide=Lus10025794 locus=Lus10025794.g ID=Lus10025794.BGIv1.0 annot-version=v1.0 MLEGKAVVNDTDMPVKRQIQAMSCASQALDLYDVLDCKSIAGHIKKEFDMRYGGGWQCVVGSNFGCFFTHSKGTFIYFTVETLKFLIFKGASSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10025794 [exp]	0	1
AT1G17750		AtPEPR2	PEP1 receptor 2 (.1)		Lus10032945 [exp]	2.2	0.7693
AT5G65060	MADS	FCL3, MAF3, AGL...	MADS AFFECTING FLOWERING 3, AG...		Lus10037038 [exp]	5.3	0.7340
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10016317 [exp]	5.5	0.7881
AT1G73830	bHLH	bHLH050, BEE3	BR enhanced expression 3 (.1.2...		Lus10009673 [exp]	5.9	0.7485
AT1G62280		SLAH1	SLAC1 homologue 1 (.1)		Lus10031545 [exp]	6.9	0.7585
AT1G27990			unknown protein		Lus10037043 [exp]	8.1	0.7375
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10035868 [exp]	9.4	0.7696
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10011697 [exp]	11.4	0.7926
AT5G48170		SNE, SLY2	SNEEZY, SLEEPY2, F-box family ...		Lus10001745 [exp]	13.0	0.7187
AT3G28345		MDR13, ABCB15	multi-drug resistance 13, ATP-...		Lus10012959 [exp]	15.9	0.7444

Compare expression of checked genes

Lus10025794 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.