Lus10025799 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79850 125 / 1e-37 PDE347, CS17, PRPS17, ORE4, RPS17 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
AT1G49400 49 / 4e-08 EMB1129 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1)
AT3G18880 47 / 2e-07 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035863 242 / 8e-84 AT1G79850 131 / 6e-40 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Lus10017467 53 / 1e-09 AT3G18880 154 / 2e-50 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10028815 52 / 2e-09 AT3G18880 154 / 4e-50 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10017993 51 / 5e-09 AT3G18880 159 / 3e-52 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G184000 117 / 3e-34 AT1G79850 139 / 1e-42 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Potri.006G080200 55 / 1e-10 AT3G18880 155 / 1e-50 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.018G150100 52 / 1e-09 AT1G49400 152 / 4e-49 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00366 Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence
>Lus10025799 pacid=23177573 polypeptide=Lus10025799 locus=Lus10025799.g ID=Lus10025799.BGIv1.0 annot-version=v1.0
ATGTCGCTCACATCTTCCCTCGCCATCTCCTCCTCCTCGTCGTGTCTCCTCAATGGCTCCTCAACTCCGCTGGTTCGCCTCTCCAAGCCCTCCTGTTCCA
CCGTCTTCCTCCCAATCAGGGCAATGAAGACGTTGGAAGGCGTAGTTGTGAAGACTTCAAGAGACAAGACGGTGGCTGTGGAGGTAACTCGTCAGGTTCA
GCATCCGAAATACCACAGAAGGGTCCGGATTAAGAAGCTCCTCCACGCCCATGACCCGGAGAACAAGTTTCAAATTGGGGATCTTGTCCAGCTTGAGAGG
AGCCGACCCATCAGTAAGACCAAGAGTTTCCTTGCTATCCCTGCACCCCCTAGGGTAAGTAAGAAGGACAAGAAAGCCAGCGCTGAGTCCACCAAGGAGG
AGCTTGGGATTCCTTTCCAATCGCAACAGTCTTAA
AA sequence
>Lus10025799 pacid=23177573 polypeptide=Lus10025799 locus=Lus10025799.g ID=Lus10025799.BGIv1.0 annot-version=v1.0
MSLTSSLAISSSSSCLLNGSSTPLVRLSKPSCSTVFLPIRAMKTLEGVVVKTSRDKTVAVEVTRQVQHPKYHRRVRIKKLLHAHDPENKFQIGDLVQLER
SRPISKTKSFLAIPAPPRVSKKDKKASAESTKEELGIPFQSQQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79850 PDE347, CS17, P... PLASTID RIBOSOMAL SMALL SUBUNI... Lus10025799 0 1
AT4G34620 SSR16 small subunit ribosomal protei... Lus10027058 2.8 0.9792
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10033200 3.2 0.9777
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10000520 5.7 0.9613
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10025642 6.3 0.9698
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10010639 6.7 0.9701
AT2G33450 Ribosomal L28 family (.1) Lus10011792 7.5 0.9654
AT5G65220 Ribosomal L29 family protein ... Lus10000745 7.7 0.9691
AT5G22340 unknown protein Lus10043400 8.4 0.9663
AT4G39710 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex... Lus10016811 8.5 0.9632
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10037822 8.5 0.9678

Lus10025799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.