Lus10025804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22900 105 / 2e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 99 / 2e-26 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 96 / 6e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 93 / 6e-24 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 85 / 7e-21 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 86 / 1e-20 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 83 / 6e-20 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 79 / 3e-18 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G38700 76 / 4e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 75 / 7e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038298 326 / 6e-116 AT5G42510 118 / 9e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021083 102 / 1e-27 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016231 102 / 2e-27 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 99 / 5e-26 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029312 91 / 3e-23 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 87 / 2e-21 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 85 / 8e-21 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 84 / 2e-20 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10018340 84 / 3e-20 AT1G58170 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 94 / 3e-24 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.008G061400 94 / 3e-24 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 90 / 1e-22 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 88 / 5e-22 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 88 / 7e-22 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 86 / 6e-21 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.006G195300 84 / 1e-20 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 83 / 6e-20 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G130900 82 / 1e-19 AT2G21110 185 / 5e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 82 / 2e-19 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10025804 pacid=23177501 polypeptide=Lus10025804 locus=Lus10025804.g ID=Lus10025804.BGIv1.0 annot-version=v1.0
ATGGCTTCCAATCTCTTCCTCTCCATCCTGACCCTCTCCGTTCTTTACATCGCCTATACTTTCCCAAGACACGACCATCACCAACCCAAGTCAACCAACC
TTGTCGTCTACGTCCATGACAAGTTCACCGGCGCGGAGGCTACTGCAGTGACGGTCGCCGGGAAACAGGATGAGCCCGCATCAGCCGCCTTCAATATCCT
GCGATTCGGGTCAGTGGCCGTAGTGGACGATCCAGTAACGGATGGCCCCACAATCGAGTCGAACGAAATCGGCAGGGCCCAGGGAGCATACATAAATTCG
CAGATGGACGGGAAGGGGCTGTATTTGGTGTTCTCCGTCATTTTCACCGGCGGGGAATTTAAAGGGAGCACGCTGGAGATACAAGGGTCTGATATTTTCT
CGATGAAGGAGAGGGAGTTTGGGGTAGTTTCGGGGACGGGTTATTTCAGATTTGTGAAAGGGTATGGGATCATGGAGACGGCGTTCATGGATGTTGCTAA
TCTTAGTGCCATTATCAAGCTTAATGTCACTGTTAAACATTACTAA
AA sequence
>Lus10025804 pacid=23177501 polypeptide=Lus10025804 locus=Lus10025804.g ID=Lus10025804.BGIv1.0 annot-version=v1.0
MASNLFLSILTLSVLYIAYTFPRHDHHQPKSTNLVVYVHDKFTGAEATAVTVAGKQDEPASAAFNILRFGSVAVVDDPVTDGPTIESNEIGRAQGAYINS
QMDGKGLYLVFSVIFTGGEFKGSTLEIQGSDIFSMKEREFGVVSGTGYFRFVKGYGIMETAFMDVANLSAIIKLNVTVKHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22900 Disease resistance-responsive ... Lus10025804 0 1
AT3G50150 Plant protein of unknown funct... Lus10010065 2.4 0.9021
AT5G02100 UNE18, ORP3A UNFERTILIZED EMBRYO SAC 18, OS... Lus10010843 3.5 0.8922
AT5G65960 GTP binding (.1) Lus10016687 5.7 0.8716
AT5G16340 AMP-dependent synthetase and l... Lus10013772 9.5 0.8806
AT5G25265 unknown protein Lus10041028 10.8 0.8615
AT4G33380 unknown protein Lus10009765 14.3 0.8651
Lus10033509 14.8 0.8733
AT1G77660 Histone H3 K4-specific methylt... Lus10028062 15.3 0.8461
AT1G54120 unknown protein Lus10008114 16.0 0.8446
AT1G27385 unknown protein Lus10015781 16.7 0.8700

Lus10025804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.