Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16240 292 / 4e-100 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT4G17340 264 / 3e-89 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT5G47450 262 / 3e-88 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT2G36830 228 / 7e-75 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT3G26520 223 / 7e-73 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT4G01470 209 / 2e-67 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT2G25810 192 / 5e-61 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT1G17810 188 / 4e-59 BETA-TIP beta-tonoplast intrinsic protein (.1) AT1G73190 184 / 1e-57 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT3G47440 161 / 1e-48 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038293 [exp] 345 / 7e-121 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10004733 [exp] 275 / 3e-93 AT5G47450 393 / 4e-140 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10007796 [exp] 272 / 4e-92 AT5G47450 389 / 1e-138 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10022611 [exp] 216 / 3e-70 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10014411 [exp] 215 / 8e-70 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 215 / 8e-70 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10021510 [exp] 215 / 9e-70 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10023913 [exp] 214 / 3e-69 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10040863 [exp] 210 / 7e-68 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G186700 [exp] 303 / 2e-104 AT3G16240 372 / 8e-132 delta tonoplast integral protein (.1) Potri.003G050900 [exp] 300 / 2e-103 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.003G077800 [exp] 274 / 6e-93 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.001G157000 [exp] 250 / 9e-84 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1) Potri.010G209900 [exp] 226 / 2e-74 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.008G050700 [exp] 226 / 3e-74 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.006G121700 [exp] 215 / 8e-70 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.016G098200 [exp] 214 / 2e-69 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.006G239700 [exp] 204 / 1e-65 AT2G25810 355 / 5e-125 tonoplast intrinsic protein 4;1 (.1) Potri.004G216500 [exp] 199 / 1e-63 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10025808 pacid=23177549 polypeptide=Lus10025808 locus=Lus10025808.g ID=Lus10025808.BGIv1.0 annot-version=v1.0 ATGGCGAAAATAGCATTCGGTAGATTTGATGACTCCTTCAGCTTCGGCTCAATCAAGGCCTACATCGCCGAGTTCATCTCTACCCTTCTCTTCGTTTTCG CTGGGGTTGGATCCGCCATCGCTTTCAATAAGCTGACAGCAGATGCAGCACTCGACCCAGCTGGACTGGTCGCAGTTGCTGTCGGACACGCACTAGCCCT CTTCGTCGCAGTCTCAGTCGGCGCCAACATCTCAGGTGGACATGTCAACCCAGCTGTCACCTTCGGATTGGCCGTCGGAGGCCAGATCACCATCCTCACT GGCATCTTCTACTGGATTGCCCAGCTCGTCGGCTCCATCGTCGCTTGCTACCTCCTCAAAGTTGTCACCGGTGGCTTGGCTATTCCAACCCACGGCGTGG CGGCGGGAGTGGGAGCATTGCAGGGAGTGGTGATGGAGATAATCATCACGTTCGGATTGGTGTACACGGTGTACGCGACCGCAGCTGATCCCAAGAAAGG TTCGTTGGGAACCATTGCTCCGATTGCAATCGGGTTCGTGGTGGGTGCGAACATATTGGCAGCCGGCCCATTCTCAGGTGGATCAATGAACCCAGCAAGG TCTTTCGGGCCGGCTGTGGCCAGTGCGGCTGTGGCCCGTGGGGGTTTCTCCGGAAACTGGATCTACTGGGTCGGGCCTCTGATCGGAGGTGGGCTTGCTG GCATTATCTACCCCAACGTCTACATGTCCTCCGACCATGCTCCTCTGGCCAGTGACTACTGA
AA sequence Show only first row Show all	>Lus10025808 pacid=23177549 polypeptide=Lus10025808 locus=Lus10025808.g ID=Lus10025808.BGIv1.0 annot-version=v1.0 MAKIAFGRFDDSFSFGSIKAYIAEFISTLLFVFAGVGSAIAFNKLTADAALDPAGLVAVAVGHALALFVAVSVGANISGGHVNPAVTFGLAVGGQITILT GIFYWIAQLVGSIVACYLLKVVTGGLAIPTHGVAAGVGALQGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFVVGANILAAGPFSGGSMNPAR SFGPAVASAAVARGGFSGNWIYWVGPLIGGGLAGIIYPNVYMSSDHAPLASDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16240		DELTA-TIP1, ATT...	delta tonoplast integral prote...		Lus10025808 [exp]	0	1
AT2G31680		AtRABA5d	RAB GTPase homolog A5D (.1)		Lus10026731 [exp]	1.0	0.8790
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10022611 [exp]	3.0	0.8448
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10021510 [exp]	6.0	0.8331
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10013113 [exp]	13.3	0.8356
AT1G04560			AWPM-19-like family protein (....		Lus10014456 [exp]	15.8	0.8175
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030586 [exp]	18.3	0.8114
AT3G07470			Protein of unknown function, D...		Lus10029538 [exp]	21.9	0.8183
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10042160 [exp]	22.6	0.8124
AT2G20760			Clathrin light chain protein (...		Lus10039815 [exp]	26.5	0.8248
AT1G67190			F-box/RNI-like superfamily pro...		Lus10020611 [exp]	31.9	0.8252

Compare expression of checked genes

Lus10025808 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.