Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66590 141 / 3e-45 ATCOX19-1 A. THALIANA CYTOCHROME C OXIDASE 19-1, cytochrome c oxidase 19-1 (.1.2) AT1G69750 141 / 3e-45 COX19-2, ATCOX19-2 A. THALIANA CYTOCHROME C OXIDASE 19-2, cytochrome c oxidase 19-2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038288 [exp] 63 / 3e-14 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G187200 [exp] 152 / 2e-49 AT1G66590 154 / 2e-50 A. THALIANA CYTOCHROME C OXIDASE 19-1, cytochrome c oxidase 19-1 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025812 pacid=23177615 polypeptide=Lus10025812 locus=Lus10025812.g ID=Lus10025812.BGIv1.0 annot-version=v1.0 ATGCTAAACGAAGATGAAAATTCTGTTACAACAGGTGGTGCATTTGGTGGAAATAGAGGGGTGAGGCCAGTGCCACCAGAGAAAGGAATCTTTCCTTTGG ACCATTTGCATGAATGTGACCTGGAAAAGAAAGACTACCTCAGCTGTCTAAAATCTGCTGGTCACCTATCAGAAAAATGCAGGCAGTTTTCAAGAAAGTA CCTCGAGTGTCGAATGGAAAAGAACTTGATGGCAAAGCAGGAGATGTCTGAACTTGGGTTCGCTGCAAAAGAGAATGAGAGGGAAGCTTCTTCAGAAGAA AATGATAAGCAGCAGCGTCTGAATGGCAAGTAA
AA sequence Show only first row Show all	>Lus10025812 pacid=23177615 polypeptide=Lus10025812 locus=Lus10025812.g ID=Lus10025812.BGIv1.0 annot-version=v1.0 MLNEDENSVTTGGAFGGNRGVRPVPPEKGIFPLDHLHECDLEKKDYLSCLKSAGHLSEKCRQFSRKYLECRMEKNLMAKQEMSELGFAAKENEREASSEE NDKQQRLNGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66590		ATCOX19-1	A. THALIANA CYTOCHROME C OXIDA...		Lus10025812 [exp]	0	1
AT4G04190			unknown protein		Lus10020577 [exp]	4.1	0.8099
AT1G08220			unknown protein		Lus10021398 [exp]	20.0	0.7824
AT1G18640		PSP	3-phosphoserine phosphatase (....		Lus10034686 [exp]	22.6	0.7667
AT5G11010			Pre-mRNA cleavage complex II p...		Lus10014756 [exp]	23.2	0.7377
AT3G54200			Late embryogenesis abundant (L...		Lus10009831 [exp]	25.8	0.7810
AT4G00290			Mechanosensitive ion channel p...		Lus10018822 [exp]	26.6	0.7620
AT5G11640			Thioredoxin superfamily protei...		Lus10011619 [exp]	30.6	0.7222
AT3G54200			Late embryogenesis abundant (L...		Lus10040941 [exp]	42.2	0.7354
AT4G03090			sequence-specific DNA binding;...		Lus10006937 [exp]	46.0	0.7624
AT1G18070			Translation elongation factor ...		Lus10018000 [exp]	50.0	0.6888

Compare expression of checked genes

Lus10025812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.