Lus10025813 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025813 pacid=23177585 polypeptide=Lus10025813 locus=Lus10025813.g ID=Lus10025813.BGIv1.0 annot-version=v1.0
ATGGATTCTGAGGATGAAGGACGACAGATGGTGCAAGTTGATAAGGAGAGCTACGAAGGAAAGCTTGAACAAGAAGAAAAGGTTGAACAAGAAGAAAAGG
TTGAACAAGAAGATAAGGAGAGCTACGAAGGCATTCCTCCGCCCCAATTTCCGACGGGAAGCGAAGCAGCGAGATATCTGGACGGAGATATGAATAGAGA
CGGCGGAACTGAAAGTGACGGCGCCGGTGGTGCAGGAAGATGGCGGTATAGTGAAGGACAGACTTGGGAAGAAAGGCCATACGGTGGCAGAACTGAAAAA
CTGAAATGA
AA sequence
>Lus10025813 pacid=23177585 polypeptide=Lus10025813 locus=Lus10025813.g ID=Lus10025813.BGIv1.0 annot-version=v1.0
MDSEDEGRQMVQVDKESYEGKLEQEEKVEQEEKVEQEDKESYEGIPPPQFPTGSEAARYLDGDMNRDGGTESDGAGGAGRWRYSEGQTWEERPYGGRTEK
LK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025813 0 1
AT5G08560 transducin family protein / WD... Lus10001412 6.7 0.7864
AT2G04480 unknown protein Lus10001750 8.7 0.7645
AT2G34930 disease resistance family prot... Lus10029483 13.6 0.7500
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10017777 14.1 0.7498
AT4G05160 AMP-dependent synthetase and l... Lus10013831 14.3 0.7597
AT5G59100 Subtilisin-like serine endopep... Lus10040751 17.1 0.6783
AT5G58050 GDPDL6, SVL4 Glycerophosphodiester phosphod... Lus10000055 19.1 0.7651
Lus10035514 21.9 0.6669
AT1G13770 RUS3 ROOT UV-B SENSITIVE 3, Protein... Lus10036909 23.5 0.7764
AT2G44290 Bifunctional inhibitor/lipid-t... Lus10017749 24.9 0.7631

Lus10025813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.