Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19740 168 / 2e-55 Ribosomal protein L31e family protein (.1) AT5G56710 168 / 2e-55 Ribosomal protein L31e family protein (.1.2) AT4G26230 168 / 2e-55 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042028 [exp] 199 / 2e-67 AT2G19740 198 / 3e-67 Ribosomal protein L31e family protein (.1) Lus10018032 [exp] 192 / 7e-65 AT2G19740 191 / 3e-64 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 201 / 1e-63 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1) Lus10015698 [exp] 169 / 2e-55 AT5G56710 201 / 2e-68 Ribosomal protein L31e family protein (.1.2) Lus10037703 [exp] 166 / 1e-54 AT5G56710 199 / 1e-67 Ribosomal protein L31e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G070100 [exp] 174 / 8e-58 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1) Potri.009G064100 [exp] 165 / 5e-54 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.001G269600 [exp] 162 / 1e-52 AT2G19740 162 / 5e-53 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [flax] [poplar] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Lus10025830 pacid=23177679 polypeptide=Lus10025830 locus=Lus10025830.g ID=Lus10025830.BGIv1.0 annot-version=v1.0 ATGGTTGAGAAGACTAGGATAAGGAAAGAGGAGGTGGTGACCAGAGAGTACACCATCAACCTTCACAAGCGGTTGCACGGCTGCACATTCAAAAAGAAGG CTCCCAAGGCCATAAAGGAGATCAGAAAGTTTGCTGAGAAGGCTATGGGAACAAAAGATGTCAGAGTGGACGTGAAGCTGAACAAACAGATCTGGAGCAA GGGGATCAGGAGTGTTCCGAGGAGAATCAGGGTTCGCATTGCACGTAAGAGGAACGATGATGAAGATGCGAAGGAGGAGCTCTATTCCCTTGTTACTGTT GCTGAGATACCAGAAGGACTTAAGGGTCTGAGCACAAAGATTATTGAAGATGAAGAGTAA
AA sequence Show only first row Show all	>Lus10025830 pacid=23177679 polypeptide=Lus10025830 locus=Lus10025830.g ID=Lus10025830.BGIv1.0 annot-version=v1.0 MVEKTRIRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLNKQIWSKGIRSVPRRIRVRIARKRNDDEDAKEELYSLVTV AEIPEGLKGLSTKIIEDEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19740			Ribosomal protein L31e family ...		Lus10025830 [exp]	0	1
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Lus10043055 [exp]	9.9	0.9084
AT2G32180		PTAC18	plastid transcriptionally acti...		Lus10030017 [exp]	10.8	0.9034
AT3G21300			RNA methyltransferase family p...		Lus10000172 [exp]	13.3	0.8715
AT3G63190		HFP108, AtcpRRF...	"ribosome recycling factor, ch...		Lus10042587 [exp]	14.6	0.9041
AT4G00165			Bifunctional inhibitor/lipid-t...		Lus10015883 [exp]	18.8	0.8841
AT3G22104			Phototropic-responsive NPH3 fa...		Lus10018499 [exp]	19.7	0.8112
AT5G11450		PPD5	PsbP domain protein 5, Mog1/Ps...		Lus10022110 [exp]	21.7	0.9030
AT1G48460			unknown protein		Lus10032738 [exp]	25.0	0.8894
AT1G17650		GR2, GLYR2	glyoxylate reductase 2 (.1)		Lus10037629 [exp]	27.3	0.8907
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Lus10029120 [exp]	31.2	0.8906

Compare expression of checked genes

Lus10025830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.