Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33467 37 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G188400 [exp] 71 / 3e-17 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025831 pacid=23177464 polypeptide=Lus10025831 locus=Lus10025831.g ID=Lus10025831.BGIv1.0 annot-version=v1.0 ATGGCCAAGATCATCGGCTGTTCCATAGAAATGGAGCCTAAGACCTTGAGCGTTGACCAACTCAATTCTGCTAGGGAATTGGCAGAAGATGTAATGCAAA ACATGCAACCGGAGGATATCTCCACTATATTCACCAAGGCAGTACTTGTTTCAGCTGAAGATATGAATCATGACAAGGGGGTTGAAGGGACCACAGTTGA GACGATGAAGAAGGGAGAGGATGAAGAAATTGATCATCTAGTCTGCCAATGTGATTGCATTCATGATGATCCCACTAATTCTGTTTACGATGAAGTCAAG CTCAAGGAGCCTTTTACTGCACCATTTTGA
AA sequence Show only first row Show all	>Lus10025831 pacid=23177464 polypeptide=Lus10025831 locus=Lus10025831.g ID=Lus10025831.BGIv1.0 annot-version=v1.0 MAKIIGCSIEMEPKTLSVDQLNSARELAEDVMQNMQPEDISTIFTKAVLVSAEDMNHDKGVEGTTVETMKKGEDEEIDHLVCQCDCIHDDPTNSVYDEVK LKEPFTAPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025831 [exp]	0	1
					Lus10017461 [exp]	5.5	0.8269
AT5G44680			DNA glycosylase superfamily pr...		Lus10036248 [exp]	7.3	0.8575
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	8.0	0.8593
AT5G54250		HLM1, DND2, ATC...	DEFENSE, NO DEATH 2, cyclic nu...		Lus10010061 [exp]	8.9	0.8438
					Lus10001828 [exp]	9.8	0.8253
AT2G20760			Clathrin light chain protein (...		Lus10039815 [exp]	10.0	0.8468
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10023208 [exp]	13.0	0.8095
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	15.6	0.8120
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10033234 [exp]	16.1	0.8082
AT2G20875		EPF1	epidermal patterning factor 1 ...		Lus10018576 [exp]	16.4	0.8364

Compare expression of checked genes

Lus10025831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.