Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33270 283 / 2e-94 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 281 / 4e-94 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT4G33260 280 / 2e-93 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G27080 272 / 7e-90 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G27945 270 / 1e-89 Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 270 / 2e-89 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G13840 189 / 1e-57 FZR3 FIZZY-related 3 (.1.2) AT4G11920 176 / 1e-52 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT4G22910 175 / 4e-52 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT1G11160 55 / 9e-09 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006851 [exp] 298 / 2e-100 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 298 / 4e-100 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 284 / 5e-98 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 300 / 7e-97 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 272 / 8e-91 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 263 / 1e-86 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 265 / 2e-83 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10011833 [exp] 187 / 1e-59 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10040282 [exp] 177 / 2e-51 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118400 [exp] 288 / 2e-96 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 283 / 2e-94 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 283 / 2e-94 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 256 / 7e-84 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.008G057500 [exp] 180 / 4e-54 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 177 / 4e-53 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.015G110300 [exp] 173 / 1e-51 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.003G119500 [exp] 171 / 1e-50 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.001G112700 [exp] 168 / 1e-49 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.007G107900 [exp] 54 / 2e-08 AT4G21130 505 / 2e-176 EMBRYO DEFECTIVE 2271, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10025838 pacid=23177634 polypeptide=Lus10025838 locus=Lus10025838.g ID=Lus10025838.BGIv1.0 annot-version=v1.0 ATGCTCACAACTGGAGGACTGGATGGTCGGATCATCAATACTGATACCAGGATCACAGAGCACATAGTCCAAACTTACAAAGGGCACAAGAAAGAAGTCT GTCGTCTCAAATTGTCAGATTCAAGCGAACAACTAGCAAGTGGAGGCACTGACAACATCCTTCACATATGGGAAAACAGGTCCATGGCTCATTCTTCATC AAATTCTTCCCCAACTGGATGGCTTCATAGGTTTGAAGAACACACTTCGGCAGTGAGGGCTATTCCATGGTGTCCTTACCAAGGAAGCTTACTTGCCTCT GGAGGAGACACTACCATCAAGTTCTGGAACACTCACAATGGTTTTTGCTTGAACTCCGTAGAGACGGGCTCTGAAGTTTGTGCACTTCTTTGGAACAAGA AAGAGAGGGAACTTCTAAGCTCACATGGTTTTCCCCAAAATCAGATCACTCTTTGGAAGTATCCATCCATGTTGAAGTCTGCTGAGCAGACCGGCAATTT CTCTAGAGCCATTTACATGGCTAATAGTCCTTACAGTTGCACGATAGCATCAGCCACAGAAGACGAAACATTGAGGTTTTGGAATGTGTTTGGTGATCCT AAAAATGTGCCCAAAAAACCTGAACCGGAGCCATTATCTTGGGCTAACCGCATCAGGTAG
AA sequence Show only first row Show all	>Lus10025838 pacid=23177634 polypeptide=Lus10025838 locus=Lus10025838.g ID=Lus10025838.BGIv1.0 annot-version=v1.0 MLTTGGLDGRIINTDTRITEHIVQTYKGHKKEVCRLKLSDSSEQLASGGTDNILHIWENRSMAHSSSNSSPTGWLHRFEEHTSAVRAIPWCPYQGSLLAS GGDTTIKFWNTHNGFCLNSVETGSEVCALLWNKKERELLSSHGFPQNQITLWKYPSMLKSAEQTGNFSRAIYMANSPYSCTIASATEDETLRFWNVFGDP KNVPKKPEPEPLSWANRIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10025838 [exp]	0	1
AT1G30190			unknown protein		Lus10023301 [exp]	2.2	0.9455
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10000611 [exp]	8.8	0.9445
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10034467 [exp]	11.2	0.9421
AT1G13520			Protein of unknown function (D...		Lus10035080 [exp]	14.8	0.9368
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Lus10008021 [exp]	19.0	0.9326
AT3G51440			Calcium-dependent phosphotries...		Lus10041827 [exp]	20.6	0.9346
AT1G47710			Serine protease inhibitor (SER...		Lus10005089 [exp]	25.4	0.9386
AT1G27040			Major facilitator superfamily ...		Lus10006477 [exp]	27.9	0.9168
AT4G17900			PLATZ transcription factor fam...		Lus10004577 [exp]	29.6	0.9330
AT5G67400		RHS19	root hair specific 19 (.1)		Lus10035204 [exp]	33.0	0.9249

Compare expression of checked genes

Lus10025838 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.