Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71950 92 / 5e-25 Proteinase inhibitor, propeptide (.1) AT5G11940 52 / 4e-09 Subtilase family protein (.1) AT4G10530 49 / 1e-07 Subtilase family protein (.1) AT4G10520 48 / 1e-07 Subtilase family protein (.1) AT4G10550 48 / 1e-07 Subtilase family protein (.1.2.3) AT4G21323 47 / 2e-07 Subtilase family protein (.1) AT1G66220 47 / 3e-07 Subtilase family protein (.1) AT1G32960 47 / 4e-07 ATSBT3.3 Subtilase family protein (.1) AT5G45650 46 / 6e-07 subtilase family protein (.1) AT4G21650 44 / 4e-06 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038252 [exp] 129 / 8e-40 AT1G71950 127 / 7e-39 Proteinase inhibitor, propeptide (.1) Lus10002964 [exp] 54 / 1e-09 AT5G59100 624 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10042555 [exp] 50 / 2e-08 AT5G59100 603 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10009867 [exp] 46 / 9e-07 AT5G59190 629 / 0.0 subtilase family protein (.1) Lus10007044 [exp] 45 / 2e-06 AT1G04110 590 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10002995 [exp] 44 / 4e-06 AT1G04110 584 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10040251 [exp] 43 / 1e-05 AT5G59190 438 / 6e-143 subtilase family protein (.1) Lus10039087 [exp] 42 / 2e-05 AT2G04160 810 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10006505 [exp] 41 / 6e-05 AT2G04160 745 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G112800 [exp] 101 / 4e-29 AT1G71950 129 / 2e-39 Proteinase inhibitor, propeptide (.1) Potri.019G083300 [exp] 101 / 1e-28 AT1G71950 130 / 8e-40 Proteinase inhibitor, propeptide (.1) Potri.011G150900 [exp] 49 / 6e-08 AT1G32960 744 / 0.0 Subtilase family protein (.1) Potri.010G196800 [exp] 47 / 3e-07 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.012G133200 [exp] 45 / 1e-06 AT5G59090 646 / 0.0 subtilase 4.12 (.1.2.3) Potri.001G450600 [exp] 45 / 1e-06 AT1G32960 772 / 0.0 Subtilase family protein (.1) Potri.011G151200 [exp] 45 / 2e-06 AT1G32960 906 / 0.0 Subtilase family protein (.1) Potri.011G050300 [exp] 44 / 3e-06 AT2G04160 786 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G050100 [exp] 44 / 3e-06 AT2G04160 784 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.001G002200 [exp] 44 / 3e-06 AT4G26330 891 / 0.0 UNFERTILIZED EMBRYO SAC 17, Subtilisin-like serine endopeptidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0570 [flax] [poplar] PPP-I PF05922 [flax] [poplar] Inhibitor_I9 Peptidase inhibitor I9
Representative CDS sequence Show only first row Show all	>Lus10025848 pacid=23177623 polypeptide=Lus10025848 locus=Lus10025848.g ID=Lus10025848.BGIv1.0 annot-version=v1.0 ATGGCCGACTCCGCACCTTCTGTTGTCCAGCCGGCGGATTCTTCCCCCGCCTCCGCTGACGCTGCTGTTCATATCGTCTACACTGAAAGGCCGGAGGGAA ACGAACAGCCCGAGGCCTATCATATCCGAACCCTCGCTTCCGTCCTCGGCAGCGAGCAGGCTGCGAAGGACGCTTTGCTTTACAGCTACAAGACGGCTGC TTCTGGCTTCTCTGCTAAGCTTACTCCCGACCAAGTCGAACAGATGTCGAGTCGTGAGAGGAATGCCTGTTTCTTGATCCTTAAGAAGAGGTTGCAGAAA TGTTTCGTGTACTGA
AA sequence Show only first row Show all	>Lus10025848 pacid=23177623 polypeptide=Lus10025848 locus=Lus10025848.g ID=Lus10025848.BGIv1.0 annot-version=v1.0 MADSAPSVVQPADSSPASADAAVHIVYTERPEGNEQPEAYHIRTLASVLGSEQAAKDALLYSYKTAASGFSAKLTPDQVEQMSSRERNACFLILKKRLQK CFVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71950			Proteinase inhibitor, propepti...		Lus10025848 [exp]	0	1
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10000802 [exp]	6.2	0.8701
AT4G26860			Predicted pyridoxal phosphate-...		Lus10032558 [exp]	6.8	0.8612
AT4G28030			Acyl-CoA N-acyltransferases (N...		Lus10019975 [exp]	11.2	0.8221
AT5G40650		SDH2-2	succinate dehydrogenase 2-2 (....		Lus10014879 [exp]	18.2	0.8107
AT3G11280	MYB		Duplicated homeodomain-like su...		Lus10009884 [exp]	20.5	0.8292
AT2G36330			Uncharacterised protein family...		Lus10002372 [exp]	22.4	0.8231
AT2G25625			unknown protein		Lus10008096 [exp]	23.0	0.8038
AT5G19590			Protein of unknown function, D...		Lus10017733 [exp]	23.3	0.7956
					Lus10040811 [exp]	26.8	0.8359
AT1G61930			Protein of unknown function, D...		Lus10020047 [exp]	30.2	0.8255

Compare expression of checked genes

Lus10025848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.