Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041761 [exp] 57 / 6e-13 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025864 pacid=23177544 polypeptide=Lus10025864 locus=Lus10025864.g ID=Lus10025864.BGIv1.0 annot-version=v1.0 ATGAAGAAGCACCCTGCTACCGAGAACATTGAAGAAGAAATCCACTCTAGTAAAGGGGATCGTGATGGTATATATACAAAGCTTCAAGGAGAGGATCTGA TTGGTTCTGTGGGGGTTGACGCATTTACTGTGCGACAGACTATGAGTAGGAAAAGTCGTCTGATGGAGGAAGGCCGTGAAGAGAAGTAA
AA sequence Show only first row Show all	>Lus10025864 pacid=23177544 polypeptide=Lus10025864 locus=Lus10025864.g ID=Lus10025864.BGIv1.0 annot-version=v1.0 MKKHPATENIEEEIHSSKGDRDGIYTKLQGEDLIGSVGVDAFTVRQTMSRKSRLMEEGREEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025864 [exp]	0	1
					Lus10041761 [exp]	1.4	0.7541
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	7.2	0.7585
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10042452 [exp]	7.5	0.6869
AT1G13810			Restriction endonuclease, type...		Lus10017632 [exp]	10.2	0.6849
AT1G70140		ATFH8	formin 8 (.1)		Lus10029212 [exp]	10.6	0.6866
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10027182 [exp]	19.4	0.6562
AT1G70140		ATFH8	formin 8 (.1)		Lus10004244 [exp]	22.1	0.6174
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10039312 [exp]	22.6	0.6843
AT1G05750		PDE247, CLB19	pigment defective 247, Tetratr...		Lus10001853 [exp]	23.0	0.6507
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10027553 [exp]	24.8	0.6776

Compare expression of checked genes

Lus10025864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.