Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 77 / 1e-19 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 76 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55460 60 / 6e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55410 60 / 6e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G55450 39 / 6e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038233 [exp] 193 / 2e-65 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002741 [exp] 78 / 6e-20 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016323 [exp] 72 / 2e-17 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 68 / 4e-16 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 62 / 9e-14 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032575 [exp] 56 / 2e-11 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019030 [exp] 42 / 5e-06 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10030541 [exp] 41 / 1e-05 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10005011 [exp] 39 / 0.0001 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G251000 [exp] 101 / 2e-29 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G149900 [exp] 90 / 1e-24 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 69 / 2e-16 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 69 / 3e-16 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G137400 [exp] 40 / 2e-05 AT5G52160 87 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10025866 pacid=23177473 polypeptide=Lus10025866 locus=Lus10025866.g ID=Lus10025866.BGIv1.0 annot-version=v1.0 ATGGCCAAGAACTGTTATTTGGTCGTGTTACTCGTGGTCTTGGTTGCCACGGCTGCAGAGGGTTCGAGGCAGCTGGCCAAGAAAGCATCACCGGATCAGC AAGTTGTGTTCTGTAACATGACTGAGGCAGGGCTTAATGCGTGCAAGCCATCGGTTACAAAGGGTAACCCGGTGGACCCTCCAGTTAAGGAGTGCTGCCA AGCTCTTGGAACAGCAGACTTGAAGTGCCTGTGCTCATACAAGAACTCTTTCGTCCTTCCTTCACTCGGGATCGACCCTGACCTCGCCATGGCTCTGCCT TCCAAGTGCAAGCTTCCCTCAGTTCCTCAATGCTAG
AA sequence Show only first row Show all	>Lus10025866 pacid=23177473 polypeptide=Lus10025866 locus=Lus10025866.g ID=Lus10025866.BGIv1.0 annot-version=v1.0 MAKNCYLVVLLVVLVATAAEGSRQLAKKASPDQQVVFCNMTEAGLNACKPSVTKGNPVDPPVKECCQALGTADLKCLCSYKNSFVLPSLGIDPDLAMALP SKCKLPSVPQC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10025866 [exp]	0	1
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10038233 [exp]	1.0	0.9825
AT4G39900			unknown protein		Lus10024045 [exp]	2.4	0.9604
AT3G53580			diaminopimelate epimerase fami...		Lus10025303 [exp]	3.2	0.9554
AT5G55410			Bifunctional inhibitor/lipid-t...		Lus10032575 [exp]	6.2	0.9607
AT2G04400			Aldolase-type TIM barrel famil...		Lus10012310 [exp]	7.3	0.9548
AT5G08550		ILP1	increased level of polyploidy1...		Lus10001926 [exp]	7.7	0.9449
AT1G27090			glycine-rich protein (.1)		Lus10037224 [exp]	8.8	0.9542
AT2G35040			AICARFT/IMPCHase bienzyme fami...		Lus10013871 [exp]	9.4	0.9521
AT3G60870	AT-hook	AHL18	AT-hook motif nuclear-localize...		Lus10009301 [exp]	9.4	0.9573
AT1G08460		HDA8, HDA08, AT...	histone deacetylase 8 (.1)		Lus10001850 [exp]	10.0	0.9500

Compare expression of checked genes

Lus10025866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.